Anti-PSPC1 antibody (ab176694)
Key features and details
- Rabbit polyclonal to PSPC1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PSPC1 antibody
See all PSPC1 primary antibodies -
Description
Rabbit polyclonal to PSPC1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human PSPC1 aa 1-50. The exact sequence is proprietary. NP_001035879.1
Sequence:MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAP
Database link: Q8WXF1 -
Positive control
- HeLa, 293T, Jurkat or Mouse NIH3T3 lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of Human PSPC1 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176694 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated PSPC1, ab176694 was used at 0.4 µg/ml.
-
All lanes : Anti-PSPC1 antibody (ab176694) at 1/0.04 dilution
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : 293T lysate at 50 µg
Lane 4 : Jurkat lysate at 50 µg
Lane 5 : Mouse NIH3T3 lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 59 kDa
Exposure time: 3 minutes

