Anti-Proteasome Activator Subunit 4/PSME4 antibody (ab157158)
Key features and details
- Rabbit polyclonal to Proteasome Activator Subunit 4/PSME4
- Suitable for: IHC-P, WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome Activator Subunit 4/PSME4 antibody
See all Proteasome Activator Subunit 4/PSME4 primary antibodies -
Description
Rabbit polyclonal to Proteasome Activator Subunit 4/PSME4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Synthetic peptide corresponding to Human Proteasome Activator Subunit 4/PSME4 aa 1-50.
Sequence:MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDL
Database link: NP_055429.2 -
Positive control
- 293T, HeLa and Jurkat whole cell lysates.
-
General notes
This product was previously labelled as Proteasome Activator Subunit 4
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab157158 was affinity purified using an epitope specific to Proteasome Activator Subunit 4/PSME4 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Proteasome Activator Subunit 4/PSME4 antibody (ab157158) at 0.4 µg/ml
Lane 1 : 293T whole
cell lysate at 50 µg
Lane 2 : 293T whole
cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole
cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 211 kDa
Exposure time: 3 minutes
-
Detection of Proteasome Activator Subunit 4/PSME4 by Western Blot of Immunprecipitate.
ab157158 at 1µg/ml labeling Proteasome Activator Subunit 4/PSME4 in 293T whole cell lysate immunoprecipitated using ab157158 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
Detection: Chemiluminescence with exposure time of 10 seconds. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Proteasome Activator Subunit 4/PSME4 antibody (ab157158)
Immunohistochemistry if human non-small cell lung cancer staining Proteasome Activator Subunit 4/PSME4 with ab157158 at 1/1000.