Anti-PLOD2/LH2 antibody (ab90088)
Key features and details
- Rabbit polyclonal to PLOD2/LH2
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PLOD2/LH2 antibody
See all PLOD2/LH2 primary antibodies -
Description
Rabbit polyclonal to PLOD2/LH2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig -
Immunogen
Synthetic peptide corresponding to Human PLOD2/LH2 aa 468-517 (internal sequence). NP_891988
Sequence:KGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQML
-
Positive control
- WB: DU145 and 293T cell lysates. IHC-P: Human bronchial epithelial tissue.
-
General notes
Protein previously labeled as PLOD2.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: PBS, 2% Sucrose -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-PLOD2/LH2 antibody (ab90088) at 1 µg/ml (in 5% skim milk / PBS buffer) + DU145 cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 85 kDa
Gel concentration: 12% -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLOD2/LH2 antibody (ab90088)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human bronchial epithelial tissue labelling PLOD2/LH2 with ab90088 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - PLOD2. Right - Merge.
-
All lanes : Anti-PLOD2/LH2 antibody (ab90088) at 4 µg/ml
Lane 1 : 293T cell lysate
Lane 2 : THP-1 cell lysate
Lysates/proteins at 25 µg per lane.
Predicted band size: 85 kDaWestern blot anlaysis labeling PLOD2 with ab90088.