Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Proteins Collagen

Anti-PLOD2/LH2 antibody (ab90088)

Anti-PLOD2/LH2 antibody (ab90088)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PLOD2/LH2
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-CTHRC1 antibody - BSA and Azide free (Capture) (ab274446)
Product image
Anti-Collagen X antibody [EPR22920-211] (ab260040)
Product image
Mouse beta IGH3 ELISA Kit (ab193717)
Product image
Recombinant Human COL4A3 protein (His tag) (ab275563)

Overview

  • Product name

    Anti-PLOD2/LH2 antibody
    See all PLOD2/LH2 primary antibodies
  • Description

    Rabbit polyclonal to PLOD2/LH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human PLOD2/LH2 aa 468-517 (internal sequence). NP_891988
    Sequence:

    KGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQML

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: DU145 and 293T cell lysates. IHC-P: Human bronchial epithelial tissue.
  • General notes

    Protein previously labeled as PLOD2.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • ECM Proteins
    • Collagen
    • Cancer
    • Cancer Metabolism
    • Response to hypoxia
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Hypoxia
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-PLOD2/LH2 antibody (ab90088)
    Western blot - Anti-PLOD2/LH2 antibody (ab90088)
    Anti-PLOD2/LH2 antibody (ab90088) at 1 µg/ml (in 5% skim milk / PBS buffer) + DU145 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 85 kDa



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLOD2/LH2 antibody (ab90088)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLOD2/LH2 antibody (ab90088)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human bronchial epithelial tissue labelling PLOD2/LH2 with ab90088 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - PLOD2. Right - Merge.

  • Western blot - Anti-PLOD2/LH2 antibody (ab90088)
    Western blot - Anti-PLOD2/LH2 antibody (ab90088)
    All lanes : Anti-PLOD2/LH2 antibody (ab90088) at 4 µg/ml

    Lane 1 : 293T cell lysate
    Lane 2 : THP-1 cell lysate

    Lysates/proteins at 25 µg per lane.

    Predicted band size: 85 kDa



    Western blot anlaysis labeling PLOD2 with ab90088.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PLOD2/LH2 antibody (ab90088)

  •  
  • Product image

    Anti-PLOD2/LH2 antibody (ab72939)

    Applications: ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-HADHB antibody (ab230667)

  •  
  • Product image

    Anti-BAF57/SMARCE1 antibody (ab70540)

  •  
  • Product image

    Anti-Ezrin antibody (ab235927)

  •  
  • Product image

    Anti-PSME3 antibody (ab180829)

  •  
  • Product image

    Anti-GALNT7 antibody (ab254975)

  •  
  • Product image

    Anti-SR140 antibody (ab195340)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.