Anti-Pea3 antibody [1A2G3] (ab70425)
Key features and details
- Mouse monoclonal [1A2G3] to Pea3
- Suitable for: Flow Cyt, WB
- Reacts with: Human, Chinese hamster, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Pea3 antibody [1A2G3]
See all Pea3 primary antibodies -
Description
Mouse monoclonal [1A2G3] to Pea3 -
Host species
Mouse -
Tested applications
Suitable for: Flow Cyt, WBmore details -
Species reactivity
Reacts with: Human, Chinese hamster, Recombinant fragment
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human Pea3 aa 50-109.
Sequence:SEDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEP QSPRTDPALS
Database link: P43268 -
Positive control
- Truncated Trx-Pea3 recombinant protein and full length Pea3 hIgGFc transfected CHO-K1 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1A2G3 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-Pea3 antibody [1A2G3] (ab70425) at 1/500 dilution
Lane 1 : Truncated Trx-Pea3 recombinant protein
Lane 2 : Full length Pea3 hIgGFc transfected CHO-K1 cell lysate
Predicted band size: 54 kDa
Observed band size: 24,60 kDa why is the actual band size different from the predicted?
-
Anti-Pea3 antibody [1A2G3] (ab70425) at 1/2000 dilution + Cell lysates prepared from K562 cells at 100 µg
Secondary
HRP-conjugated Goat polyclonal to mouse IgG1
Predicted band size: 54 kDa
-
Overlay histogram showing K562 cells stained with ab70425 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab70425, 1/100 dilution) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in K562 cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.