Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Microbiology Interspecies Interaction Host Virus Interaction

Anti-Pea3 antibody [1A2G3] (ab70425)

Price and availability

284 784 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-Pea3 antibody [1A2G3] (ab70425)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [1A2G3] to Pea3
  • Suitable for: Flow Cyt, WB
  • Reacts with: Human, Chinese hamster, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant Human CRTC3 protein (ab153493)
Product image
Anti-CX3CR1 antibody (ab167571)
Product image
Human BTRC (Beta TRCP/HOS) knockout HEK293T cell pellet (ab279200)
Product image
Anti-Bovine Papilloma Virus E2 antibody [1H10] (ab77174)

Overview

  • Product name

    Anti-Pea3 antibody [1A2G3]
    See all Pea3 primary antibodies
  • Description

    Mouse monoclonal [1A2G3] to Pea3
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human, Chinese hamster, Recombinant fragment
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Pea3 aa 50-109.
    Sequence:

    SEDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEP QSPRTDPALS


    Database link: P43268
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Truncated Trx-Pea3 recombinant protein and full length Pea3 hIgGFc transfected CHO-K1 cell lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1A2G3
  • Isotype

    IgG1
  • Research areas

    • Microbiology
    • Interspecies Interaction
    • Host Virus Interaction
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Ets

Images

  • Western blot - Anti-Pea3 antibody [1A2G3] (ab70425)
    Western blot - Anti-Pea3 antibody [1A2G3] (ab70425)
    All lanes : Anti-Pea3 antibody [1A2G3] (ab70425) at 1/500 dilution

    Lane 1 : Truncated Trx-Pea3 recombinant protein
    Lane 2 : Full length Pea3 hIgGFc transfected CHO-K1 cell lysate

    Predicted band size: 54 kDa
    Observed band size: 24,60 kDa
    why is the actual band size different from the predicted?

  • Western blot - Anti-Pea3 antibody [1A2G3] (ab70425)
    Western blot - Anti-Pea3 antibody [1A2G3] (ab70425)
    Anti-Pea3 antibody [1A2G3] (ab70425) at 1/2000 dilution + Cell lysates prepared from K562 cells at 100 µg

    Secondary
    HRP-conjugated Goat polyclonal to mouse IgG1


    Predicted band size: 54 kDa

  • Flow Cytometry - Anti-Pea3 antibody [1A2G3] (ab70425)
    Flow Cytometry - Anti-Pea3 antibody [1A2G3] (ab70425)
    Overlay histogram showing K562 cells stained with ab70425 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab70425, 1/100 dilution) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in K562 cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Pea3 antibody [1A2G3] (ab70425)

  •  
  • Product image

    Anti-Pea3 antibody (ab189826)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Pea3 antibody (ab98068)

    Applications: WB

  •  
  • Product image

    Anti-Pea3 antibody [OTI5C11] (ab236503)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-SNRPD3/Sm-D3 antibody (ab157118)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.