Anti-PAXX antibody (ab126353)
Key features and details
- Rabbit polyclonal to PAXX
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PAXX antibody -
Description
Rabbit polyclonal to PAXX -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PAXX aa 109-204.
Sequence:LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGP QLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
-
Positive control
- IHC_P: Human pancreas, prostate and stomach tissue RT4, U251 MG, Human liver tissue and Human tonsil tissue lysates.
-
General notes
Protein target previously labeled as C9orf142.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-PAXX antibody (ab126353) at 1/250 dilution
Lane 1 : RT4 cell lysate
Lane 2 : U251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 22 kDa
-
ab126353 at a 1/1000 dilution staining PAXX in paraffin embedded Human pancreas tissue by immunohistochemistry.
-
Immunofluorescent staining of Human cell line U-251 MG shows positivity in nucleus but not nucleoli. Recommended concentration of ab126353 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemical analysis of human stomach tissue labeling PAXX with ab126353 at 1/2500 dilution.
-
Immunohistochemical analysis of human prostate tissue labeling PAXX with ab126353 at 1/2500 dilution.
-
Immunohistochemical analysis of human skeletal muscle tissue labeling PAXX with ab126353 at 1/2500 dilution. No positivity seen in myocytes as expected.