Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Other Antibodies

Anti-PAXX antibody (ab126353)

Price and availability

348 441 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-PAXX antibody (ab126353)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PAXX
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-DCUN1D4 antibody (ab154095)
Product image
Anti-ANKDD1A antibody (ab243526)
Product image
Anti-LSM12 antibody [EPR12282] - BSA and Azide free (ab249752)
Product image
Anti-IFT140 antibody (ab238109)

Overview

  • Product name

    Anti-PAXX antibody
  • Description

    Rabbit polyclonal to PAXX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PAXX aa 109-204.
    Sequence:

    LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGP QLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC_P: Human pancreas, prostate and stomach tissue RT4, U251 MG, Human liver tissue and Human tonsil tissue lysates.
  • General notes

    Protein target previously labeled as C9orf142. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Other Antibodies
    • Other Antibodies

Images

  • Western blot - Anti-PAXX antibody (ab126353)
    Western blot - Anti-PAXX antibody (ab126353)
    All lanes : Anti-PAXX antibody (ab126353) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 22 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)

    ab126353 at a 1/1000 dilution staining PAXX in paraffin embedded Human pancreas tissue by immunohistochemistry.

  • Immunocytochemistry/ Immunofluorescence - Anti-PAXX antibody (ab126353)
    Immunocytochemistry/ Immunofluorescence - Anti-PAXX antibody (ab126353)
    Immunofluorescent staining of Human cell line U-251 MG shows positivity in nucleus but not nucleoli. Recommended concentration of ab126353 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemical analysis of human stomach tissue labeling PAXX with ab126353 at 1/2500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemical analysis of human prostate tissue labeling PAXX with ab126353 at 1/2500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PAXX antibody (ab126353)
    Immunohistochemical analysis of human skeletal muscle tissue labeling PAXX with ab126353 at 1/2500 dilution. No positivity seen in myocytes as expected.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-TC10 antibody [Y304] (ab32079)

  •  
  • Product image

    Anti-CNKSR3 antibody (ab168304)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.