Anti-PAX3 antibody (ab180754)
Key features and details
- Rabbit polyclonal to PAX3
- Suitable for: ICC, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PAX3 antibody
See all PAX3 primary antibodies -
Description
Rabbit polyclonal to PAX3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Xenopus laevis -
Immunogen
Recombinant full length protein corresponding to Human PAX3 aa 1-206.
Sequence:MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRP LPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGA IGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPS VSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERGKALV SGVSSH
Database link: P23760-3 -
Positive control
- WB: U-251 MG whole cell lysate; ICC: MCF-7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-PAX3 antibody (ab180754) at 1/1000 dilution
Lane 1 : U-251 MG (formally U-373 MG) (human brain glioma cell line) whole cell lysate
Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : Goat Anti-Rabbit IgG (H+L) (HRP) at 1/10000 dilution
Predicted band size: 23 kDaBlocking buffer: 3% NFDM/TBST.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180754. Blue DAPI for nuclear staining.