Anti-p46 antibody (ab121568)
Key features and details
- Rabbit polyclonal to p46
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-p46 antibody
See all p46 primary antibodies -
Description
Rabbit polyclonal to p46 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human p46 aa 5-95.
Sequence:SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRF DARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR
-
Positive control
- Human testis tissue; RT4 and U251 MG cell lysates; A431 cells.
-
General notes
Previously labelled as SKAR.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-p46 antibody (ab121568)Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p46 antibody (ab121568)ab121568 at 1/20 dilution staining p46 in Paraffin-embedded Human Testis tissue by Immunohistochemistry.
-
Immunocytochemistry/ Immunofluorescence - Anti-p46 antibody (ab121568)ab121568 at 4 µg/ml staining p46 in PFA/Triton X-100 fixed/permeabilized A431 cells by Immunofluorescence (green).
-
Western blot - Anti-p46 antibody (ab121568)All lanes : Anti-p46 antibody (ab121568) at 1/250 dilution
Lane 1 : RT4 lysate
Lane 2 : Human liver lysate
Lane 3 : U251 MG lysate
Lane 4 : Human plasma
Lane 5 : Human tonsil lysate
Developed using the ECL technique.
