Anti-P2X4 antibody (ab168939)
Key features and details
- Mouse polyclonal to P2X4
- Suitable for: WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-P2X4 antibody
See all P2X4 primary antibodies -
Description
Mouse polyclonal to P2X4 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanWB Human -
Immunogen
Full length protein corresponding to Human P2X4 aa 1-388.
Sequence:MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVW EKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLF VMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCV AFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNF SKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEG GIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYY RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMAT VLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Database link: NP_002551.2 -
Positive control
- P2X4 transfected 293T cell lysate; P2X4 expressing 293 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Flow cytometric analysis of negative control 293 cells (Black) and P2X4 expressing 293 cells (Green) labeling P2X4 with ab168939 at 1 ug/ml.
-
All lanes : Anti-P2X4 antibody (ab168939) at 1 µg/ml
Lane 1 : P2X4 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Developed using the ECL technique.
Predicted band size: 43 kDa