Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Energy Metabolism

Anti-NMNAT2 antibody (ab56980)

Price and availability

381 945 ₸

Availability

Order now and get it on Friday March 05, 2021

Anti-NMNAT2 antibody (ab56980)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to NMNAT2
  • Suitable for: ICC/IF, WB, IHC-P, Flow Cyt
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant human GLO1 protein (ab87413)
Product image
Recombinant human AK 1 protein (ab167983)
Product image
Anti-NDUFB10 antibody [EPR16230] (ab192245)
Product image
Anti-Mannose Phosphate Isomerase antibody [EPR10234] (ab154198)

Overview

  • Product name

    Anti-NMNAT2 antibody
    See all NMNAT2 primary antibodies
  • Description

    Mouse monoclonal to NMNAT2
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human NMNAT2 aa 208-308.
    Sequence:

    CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVV KDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG


    Database link: Q9BZQ4
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC/IF: SHSY5Y cells. IHC-P: Human breast cancer Flow cyt: SH-SY5Y cells.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Vitamins / minerals
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-NMNAT2 antibody (ab56980)
    Western blot - Anti-NMNAT2 antibody (ab56980)

    Western blot against tagged recombinant protein immunogen using ab56980 NMNAT2 antibody at 1ug/ml. Predicted band size of immunogen is 37 kDa

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-NMNAT2 antibody (ab56980)
    Immunocytochemistry/ Immunofluorescence - Anti-NMNAT2 antibody (ab56980)

    ICC/IF image of ab56980 stained SHSY5Y cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56980, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NMNAT2 antibody (ab56980)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NMNAT2 antibody (ab56980)

    IHC image of ab56980 staining in human breast cancer formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab56980, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-NMNAT2 antibody (ab56980)
    Flow Cytometry - Anti-NMNAT2 antibody (ab56980)

    Overlay histogram showing SH-SY5Y cells stained with ab56980 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56980, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.
    This image was generated using the ascites version of the product.

  • Western blot - Anti-NMNAT2 antibody (ab56980)
    Western blot - Anti-NMNAT2 antibody (ab56980) This image is courtesy of an abreview submitted by Jon Gilley, The Babraham Institute, United Kingdom
    Anti-NMNAT2 antibody (ab56980) at 2 µg/ml + mouse brain from newborn pup at 40 µg

    Secondary
    Goat Anti-Mouse IgG (H+L)-HRP Conjugate at 1/3000 dilution

    Predicted band size: 34 kDa



    Nmnat2 is a low abundance protein and is difficult to detect. Although multiple non-specific bands are detected by this antibody, we find it is the best commercial antibody for detecting endogenous Nmnat2 as the band is found approximately mid-way between the 25 and 37 kDa markers (at ~32 kDa) and can relatively easily be distinguished from nearby non-specific bands (N.B. a non-specific band at ~37 kDa is also detected in mouse brain extracts from adult mice). Importantly, we do not use this antibody in any immunostaining techniques due to its cross-reactivity with multiple other proteins. The size of the specific band corresponding to endogenous Nmnat2 (32 kDa) was determined based on its migration relative to that of FLAG-tagged Nmnat2 in tranfected HEK cells (which migrates slightly slower at ~34 kDa) and loss of the endogenous Nmnat2 band in transected axons in primary neuronal cultures and in gene trap mouse brain extracts (Gilley and Coleman, PLoS Biology, 2010 [PMID: 20126265]

    This image was generated using the ascites version of the product.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-NMNAT2 antibody (ab56980)

  •  
  • Product image

    Anti-NMNAT2 antibody (ab110040)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-NMNAT2 antibody (ab222893)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CHD6 antibody [2174C2a] (ab51330)

  •  
  • Product image

    Anti-ZFR2 antibody (ab204415)

  •  
  • Product image

    Anti-SEMA6B antibody (ab204750)

  •  
  • Product image

    Anti-Swi6 antibody (ab188276)

  •  
  • Product image

    Anti-Apo-H antibody (ab115215)

  •  
  • Product image

    Anti-S6K1 antibody (ab227772)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.