Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Cell Type Marker Neuron marker Soma marker

Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

Price and availability

321 638 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [1B7] to NeuN - Neuronal Marker
  • Suitable for: ICC, IHC-P, WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG2b

You may also be interested in

Product image
Anti-GAD65 + GAD67 antibody [EPR19366] - BSA and Azide free (ab240280)
Product image
Alexa Fluor® 488 Anti-Coilin antibody [IH10] (ab197531)
Product image
Anti-NSE antibody [ENO2/1375] - BSA and Azide free (ab218856)
Product image
Anti-EEA1 antibody - C-terminal (ab137403)

Overview

  • Product name

    Anti-NeuN antibody [1B7] - Neuronal Marker
    See all NeuN primary antibodies
  • Description

    Mouse monoclonal [1B7] to NeuN - Neuronal Marker
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ICC
    Rat
    ICC/IF
    Rat
    IHC-P
    Mouse
    Rat
    Human
    WB
    Rat
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human NeuN aa 1-100 (N terminal). Expressed in and purified from E. coli.
    Sequence:

    MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTP AQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR


    Database link: Q8BIF2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Rat brain tissue. Mouse cerebellum tissue. Human hippocampus tissue. ICC/IF: Rat brain neural cultures. WB: Adult mouse and rat whole brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.03% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    1B7
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Soma marker
    • Tags & Cell Markers
    • Cell Type Markers
    • Neuroscience Markers
    • Neuronal
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Forkhead Box
    • Other FOXes
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors

Images

  • Immunocytochemistry - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Immunocytochemistry - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

    ab104224 staining NeuN - Neuronal Marker in primary hippocampal rat neurons/glia, (obtained from Neuromics, cat. no. PC35101), DIV14. The cells were fixed with 100% methanol (5 min), permeabilized with 0.1% PBS-Triton X-100 for 5 minutes and then blocked with 1% BSA/10% normal goat serum/0.3M glycine in 0.1%PBS-Tween for 1h. The cells were then incubated overnight at 4°C with ab104224 at 0.1µg/ml and ab6046, Rabbit polyclonal to beta Tubulin - Loading Control. Cells were then incubated with ab150117, Goat polyclonal Secondary Antibody to Mouse IgG H&L (Alexa Fluor® 488) preadsorbed at 1/1000 dilution (shown in green) and ab150080, Goat polyclonal Secondary Antibody to Rabbit IgG - H&L (Alexa Fluor® 594) at 1/1000 dilution (shown in pseudocolour red). Nuclear DNA was labelled with DAPI (shown in blue).

    Also suitable in cells fixed with 4% paraformaldehyde (10 min).

    Image was acquired with a high-content analyser (Operetta CLS, Perkin Elmer) and a maximum intensity projection of confocal sections is shown.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

    IHC image of NeuN staining in rat brain formalin-fixed paraffin-embedded tissue section, performed on a Leica Bond™ system using the standard protocol F.

    The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6, epitope retrieval solution 1) for 20 minutes. The section was then incubated with ab104224, 1 µg/ml, for 15 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

     

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

     

  • Western blot - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Western blot - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    All lanes : Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224) at 1/1000 dilution

    Lane 2 : Adult rat whole brain lysate
    Lane 3 : Embryonic E20 rat whole brain lysate
    Lane 4 : Adult mouse whole brain lysate

    Predicted band size: 46, 48 kDa

  • Immunocytochemistry - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Immunocytochemistry - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

    Rat brain neural cultures stained with ab104224 in pink, with ab4674 (chicken polyclonal to GFAP)  in green and DNA in blue. ab104224 reveals strong nuclear and distal cytoplasmic staining. It does not stain astrocytes and other non-neuronal cells.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

    IHC image of NeuN staining in mouse cerebellum formalin-fixed paraffin-embedded tissue section, performed on a Leica Bond™ system using the standard protocol B.

    The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6, epitope retrieval solution 1) for 20 minutes. The section was then incubated with ab104224, 1 µg/ml, for 15 minutes at room temperature. A goat anti-rabbit biotinylated secondary antibody was used to detect the primary, and visualized using an HRP conjugated ABC system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

     

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

  • Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Immunocytochemistry/ Immunofluorescence - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

    Immunofluorescent analysis of rat brain stem co-stained with ab104224 in green, and a chicken pAb to microtubule associated protein 2 (MAP2) in red. Blue is DAPI staining of nuclear DNA.

    Following transcardial perfusion with 4% paraformaldehyde, the brain was post fixed for 24 hours, cut to 45μM, and free-floating sections were stained. The Fox3/NeuN antibody selectively stains nuclei and the proximal cytoplasm of neuronal cells while the MAP2 antibody labels dendrites and overlaps with Fox3/NeuN staining in the perikarya of neurons.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

    IHC image of FOX3/NeuN staining in human normal hippocampus formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F.

    The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 minutes. The section was then incubated with ab104224, 5 µg/ml, for 15 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-NeuN antibody [1B7] - Neuronal Marker (ab104224)

  •  
  • Product image

    Alexa Fluor® 555 Anti-NeuN antibody [EPR12763] - Neuronal Marker (ab207281)

    Applications: ICC/IF

  •  
  • Product image

    Anti-NeuN antibody [EPR12763] - Neuronal Marker (ab177487)

    Applications: Flow Cyt, ICC/IF, IHC (PFA fixed), IHC-Fr, IHC-P, mIHC, WB

  •  
  • Product image

    Biotin Anti-NeuN antibody [EPR12763] (ab204681)

    Applications: IHC-P

  •  
  • Product image

    Alexa Fluor® 647 Anti-NeuN antibody [EPR12763] - Neuronal Marker (ab190565)

    Applications: ICC/IF, IHC-Fr, IHC-P

  •  
  • Product image

    Alexa Fluor® 594 Anti-NeuN antibody [EPR12763] - Neuronal Marker (ab207279)

    Applications: ICC

  •  
  • Product image

    Alexa Fluor® 488 Anti-NeuN antibody [EPR12763] - Neuronal Marker (ab190195)

    Applications: Flow Cyt, ICC/IF, IHC-Fr

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Lhx2/LH2 antibody [EPR20449] (ab184337)

  •  
  • Product image

    Anti-Collagen I antibody [EPR7785] (ab138492)

  •  
  • Product image

    Anti-Histone H3 (di methyl K36) antibody - ChIP Grade (ab9049)

  •  
  • Product image

    Anti-Clostridium difficile Toxin A antibody [EPR23359-15] (ab272720)

  •  
  • Product image

    FITC Anti-Glycophorin A antibody [YTH89.1] (ab28082)

  •  
  • Product image

    Recombinant human Acetyl Coenzyme A Carboxylase protein (ab196428)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.