Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-Ndufs1 antibody (ab22094)

Price and availability

268 032 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-Ndufs1 antibody (ab22094)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse polyclonal to Ndufs1
  • Suitable for: WB
  • Reacts with: Recombinant fragment
  • Isotype: IgG

You may also be interested in

Product image
Human ARNTL (BMAL1) knockout HeLa cell lysate (ab258314)
Product image
Cardiolipin Assay Kit (ab241036)
Product image
Rabbit specific HRP/AEC (ABC) Detection IHC Kit (ab64260)
Endomorphin-1, mu agonist (ab120411)

Overview

  • Product name

    Anti-Ndufs1 antibody
    See all Ndufs1 primary antibodies
  • Description

    Mouse polyclonal to Ndufs1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Chicken, Cow, Xenopus laevis, Chimpanzee, Zebrafish
  • Immunogen

    Fusion protein:

    TNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRF LEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGND

    , corresponding to amino acids 104/203 of Mouse Ndufs1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Produced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    Constituent: 50% Glycerol
  • Concentration information loading...
  • Purity

    Whole antiserum
  • Primary antibody notes

    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Mitochondria
    • Neuroscience
    • Neurology process
    • Metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Integration of energy metabolism
    • Cancer
    • Cancer Metabolism
    • Cellular metabolic process
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial markers
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Integration of energy
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Oxidative phosphorylation
    • Complex I
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-Ndufs1 antibody (ab22094)
    Western blot - Anti-Ndufs1 antibody (ab22094)
    All lanes : Anti-Ndufs1 antibody (ab22094) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
    negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
    antigen fusion protein at 20 ug

    Secondary
    All lanes : Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
    1/5000 dilution

    Predicted band size: 79 kDa



    The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Ndufs1 antibody (ab22094)

  •  
  • Product image

    Alexa Fluor® 488 Anti-Ndufs1 antibody [EPR11521(B)] (ab198954)

    Applications: ICC/IF

  •  
  • Product image

    Anti-Ndufs1 antibody [EPR11521(B)] (ab169540)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Ndufs1 antibody (ab185733)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Ndufs1 antibody [EPR11522(B)] (ab157221)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-Ndufs1 antibody [EPR11521(B)] (ab198956)

    Applications: ICC/IF

  •  
  • Product image

    Anti-Ndufs1 antibody (ab96428)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Cystathionase/CTH antibody (ab54573)

  •  
  • Product image

    Anti-beta Synuclein antibody - C-terminal (ab189276)

  •  
  • Product image

    Anti-RPL37 antibody (ab228542)

  •  
  • Product image

    Anti-KIF5A antibody (ab5628)

  •  
  • Product image

    Anti-Hsp70 antibody (ab124208)

  •  
  • Product image

    Anti-mGluR1a antibody (ab51314)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.