Anti-Mov10 antibody [15C1B8] (ab176687)
Key features and details
- Mouse monoclonal [15C1B8] to Mov10
- Suitable for: IHC-P, WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Mov10 antibody [15C1B8]
See all Mov10 primary antibodies -
Description
Mouse monoclonal [15C1B8] to Mov10 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanIP MouseWB Mouse -
Immunogen
Synthetic peptide within Human Mov10 aa 953-1003. The exact sequence is proprietary. NP_066014.1.
Sequence:LDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNE L
Database link: Q9HCE1 -
Positive control
- Mouse NIH3T3, 293T, HeLa and Jurkat lysate. Human testicular seminoma tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Monoclonal -
Clone number
15C1B8 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
All lanes : Anti-Mov10 antibody [15C1B8] (ab176687) at 0.1 µg/ml
Lane 1 : Mouse NIH-3T3 lysate at 50 µg
Lane 2 : Mouse NIH-3T3 lysate at 15 µg
Lane 3 : 293T lysate at 50 µg
Lane 4 : HeLa lysate at 50 µg
Lane 5 : Jurkat lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 114 kDa
Exposure time: 3 minutes
-
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testicular seminoma tissue labeling Mov10 with ab176687 at a 1/1000 dilution. DAB staining.
-
Detection of Human Mov10 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP Mouse NIH3T3 whole cell lysate loaded. ab176687 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated Mov10, ab176687 was used at 1 µg/ml.