Anti-LETMD1/HCCR-1 antibody (ab175410)
Key features and details
- Rabbit polyclonal to LETMD1/HCCR-1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-LETMD1/HCCR-1 antibody
See all LETMD1/HCCR-1 primary antibodies -
Description
Rabbit polyclonal to LETMD1/HCCR-1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human LETMD1/HCCR-1 aa 1-360.
Sequence:MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPK ADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADA KKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFA NYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEK VIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQ ALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTA QEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVL LSTNYLGTRR
Database link: Q6P1Q0 -
Positive control
- PANC1 cell extract.
-
General notes
This product was previously labelled as LETMD1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175410. Blue DAPI for nuclear staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LETMD1/HCCR-1 antibody (ab175410)
Immunohistochemistry of paraffin-embedded rat kidney damage using ab175410 at dilution of 1:100
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LETMD1/HCCR-1 antibody (ab175410)
Immunohistochemistry of paraffin-embedded human liver damage using ab175410 at dilution of 1:100
-
All lanes : Anti-LETMD1/HCCR-1 antibody (ab175410) at 1/1000 dilution
Lane 1 : MCF7 cell lysate with 3% nonfat dry milk in TBST.
Lane 2 : Mouse liver lysate with 3% nonfat dry milk in TBST.
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/1000 dilution
Developed using the ECL technique.
Predicted band size: 42 kDa
Exposure time: 90 seconds
-
Anti-LETMD1/HCCR-1 antibody (ab175410) at 1/500 dilution + PANC1 cell extract
Predicted band size: 42 kDa