Anti-KIF4A/KIF4 antibody (ab122227)
Key features and details
- Rabbit polyclonal to KIF4A/KIF4
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KIF4A/KIF4 antibody
See all KIF4A/KIF4 primary antibodies -
Description
Rabbit polyclonal to KIF4A/KIF4 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human KIF4A/KIF4 aa 994-1075.
Sequence:LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIED LKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL
Database link: O95239 -
Positive control
- WB: RT-4 and U-251 MG cell lysates IHC-P: Human bone marrow tissue ICC/IF: Human cell line U-2 OS
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-KIF4A/KIF4 antibody (ab122227) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KIF4A/KIF4 antibody (ab122227)ab122227, at a 1/300 dilution, staining KIF4A/KIF4 in paraffin embedded Human bone marrow tissue by Immunohistochemistry.
-
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli using ab122227.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KIF4A/KIF4 antibody (ab122227)Immunohistochemical staining of Human bone marrow shows strong nuclear positivity in hematopoietic cells using ab122227
-
ab122227, at 4 µg/ml, staining KIF4A/KIF4 in Human cell line U-2 OS by Immunofluorescence. Antibody staining is shown in green.

