Anti-Hsp70 antibody (ab79852)
Key features and details
- Rabbit polyclonal to Hsp70
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: n/a
Overview
-
Product name
Anti-Hsp70 antibody
See all Hsp70 primary antibodies -
Description
Rabbit polyclonal to Hsp70 -
Host species
Rabbit -
Specificity
Detects a 70kDa protein corresponding to the molecular mass of inducible hsp70. May cross-react with Hsc70 at lower dilutions. -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB MouseHuman -
Immunogen
Full length protein corresponding to Human Hsp70 aa 1-641.
Sequence:MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL IGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDK PKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYF NDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL GGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHK KDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLS LGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMT KDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANK ITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
Database link: P08107 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Research areas
Images
-
All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution
Lane 1 : Cell lysates prepared from mouse Pam212 cells
Lane 2 : Molecular weight marker
-
Immunohistochemistry of human colon carcinoma staining Hsp70 using ab79852 at 1:50000. A Biotin conjugated Goat Anti-Rabbit antibody at 1:2000 was used as a secondary antibody and Methyl Green at 200uL was used to counter stain.
-
Immunocytochemistry/Immunofluorescence analysis of heat shocked HeLa cells staining Hsp70 using ab79852 at a 1:100 dilution. The secondary antibody was a FITC conjugated Goat Anti-Rabbit (green) at a 1:200 dilution. Counterstain: DAPI (blue) nuclear stain at 1:40000. A) DAPI (blue) nuclear stain. (B) Anti-Hsp70 Antibody. (C) Composite.
-
ab79852 staining Hsp70 in mouse backskin tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).
-
All lanes : Anti-Hsp70 antibody (ab79852) at 1/25000 dilution
Lane 1 : Molecular weight marker
Lane 2 : Cell lysates prepared from human A431 cells
Lane 3 : Cell lysates prepared from human A549 cells
Lane 4 : Cell lysates prepared from human HCT116 cells
Lane 5 : Cell lysates prepared from Hela cells
Lane 6 : Cell lysates prepared from HEK293 cells
Lane 7 : Cell lysates prepared from HepG2 cells
Lane 8 : Cell lysates prepared from HL-60 cells
Lane 9 : Cell lysates prepared from HUVEC cells
Lane 10 : Cell lysates prepared from Jurkat cells
Lane 11 : Cell lysates prepared from MCF7 cells
Lane 12 : Cell lysates prepared from PC3 cells
Lane 13 : Cell lysates prepared from T98G cells
Lane 14 : Tissue lysates prepared from Rat brain