Anti-HHV6AgQ1 antibody [119] - BSA and Azide free (ab179902)
Key features and details
- Mouse monoclonal [119] to HHV6AgQ1
- Suitable for: Flow Cyt (Intra), ELISA, WB, ICC/IF, IP
- Reacts with: Human herpesvirus 6
- Isotype: IgG
Overview
-
Product name
Anti-HHV6AgQ1 antibody [119] - BSA and Azide free -
Description
Mouse monoclonal [119] to HHV6AgQ1 -
Host species
Mouse -
Specificity
ab179902 reacts with gQ1 of HHV6A and HHV6B. This antibody is not recommended for IP of HHV-6B. -
Tested applications
Suitable for: Flow Cyt (Intra), ELISA, WB, ICC/IF, IPmore details -
Species reactivity
Reacts with: Human herpesvirus 6 -
Immunogen
Recombinant fragment (His-tag) corresponding to Human Herpesvirus HHV6AgQ1 aa 3-422. (Expressed in E. coli).
Sequence:TARLSAMKPPRSCALIFLCAFSMATAPTNATAHRRAGTVKSTPPPEDKHS YTAKYYDKDIYFNIYEGRNSTPRRRTLSEIISKFSTSEMLSLKRVKAFVP VDENPTTTLEDIADILNYAVCDDNSCGCTIETQARIMFGDIIICVPLSAD NKGVRNFKDRIMPKGLSQILSSSLGLHLSLLYGAFGSNYNSLAYMRRLKP LTAMTAIRFCPMTTKLELRQNYKVKETLCELIVSIEILKIRNNGGQTMKT LTSFAIVRKDNDGQDWETCTRFAPVNIEDILRYKRVANDTCCRHRDVQHG RRTLESSNSWTQTQYFEPWQDIVDVYVPINDTHCPNDSYVVFETLQGFEW CSRLNKNETKNYLSSVLGFRNALFETEELMETIAMRLASQILSMVGQQGT TIRDIDPAIVSALWHSLPEN
Database link: Q69572 -
Positive control
- T-cell line HSB-2 cells infected with HHV-6A; 293T cells transfected with HHV6 U100 expression plasmid. 293T cells : Flow Cyt (Intra).
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6
Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS -
Concentration information loading...
-
Purity
Proprietary Purification -
Purification notes
ab179902 is produced in serum-free medium and purified by proprietary chromatography procedures under mild conditions. ab179902 is 90~95% pure by SDS-PAGE and is filter-sterilised. -
Clonality
Monoclonal -
Clone number
119 -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-HHV6AgQ1 antibody [119] - BSA and Azide free (ab179902)
Lane 1 : Non-treated
Lane 2 : Treated with end-glycosilase
Lane 3 : Treated with peptide N -glycosidasegQ1 is detected as two glycoproteins with 80 kDa and 74 kDa molecular masses
-
All lanes : Anti-HHV6AgQ1 antibody [119] - BSA and Azide free (ab179902)
Lane 1 : HSB-2 cells
Lane 2 : HSB-2 cells infected with HHV-6A GS strain
-
Immunocytochemistry/ Immunofluorescence - Anti-HHV6AgQ1 antibody [119] - BSA and Azide free (ab179902)
Immunofluorescent analysis of HHV6A-infected HSB-2 cells labeling HHV6 U100 using FITC-conjugated ab179902 at 1/200 dilution. The infected cells were harvested 3 days postinfection, fixed in cold acetone.
-
293T cells were transfected with gQ1 expression plasmid. The cells were harvested on second day postinfection, fixed with 4% PFA, permeabilized with 0.1% Triton-X100, incubated with anti-gQ1 antibody (119) and then with FITC-conjugated anti-mouse IgG antibody.Histograms show fluorescence intensities measured in arbitary units on a log scale (x axis) and relative cell numbers on a linear scale (y axis).Black line is control and red line is gQ1 introduced cells.