Anti-GLO1 antibody [Glo1a] (ab171121)
Key features and details
- Mouse monoclonal [Glo1a] to GLO1
- Suitable for: WB, IHC-P
- Knockout validated
- Reacts with: Mouse, Rat, Human, African green monkey
- Isotype: IgG
Overview
-
Product name
Anti-GLO1 antibody [Glo1a]
See all GLO1 primary antibodies -
Description
Mouse monoclonal [Glo1a] to GLO1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanWB Human -
Immunogen
Recombinant full length protein (proprietary-tag) corresponding to Human GLO1 aa 1-184.
Sequence:MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYT RVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Database link: Q04760 -
Positive control
- HeLa, HepG2, 293T, A431, A549, MCF7, U2OS, K562, monkey COS7, mouse MEF, mouse C2C12 and rat NRK cell lysates; Human prostate and stomach cancer tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 99% PBS, 0.1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
Glo1a -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution
Lane 1 : Wild-type HAP1 whole cell lysate
Lane 2 : GLO1 knockout HAP1 whole cell lysate
Lane 3 : HeLa whole cell lysate
Lane 4 : HepG2 whole cell lysate
Lysates/proteins at 20 µg per lane.
Predicted band size: 21 kDaLanes 1 - 4: Merged signal (red and green). Green - ab171121 observed at 21 kDa. Red - loading control, ab181602, observed at 37 kDa.
ab171121 was shown to specifically react with in wild-type HAP1 cells as signal was lost in GLO1 knockout cells. Wild-type and GLO1 knockout samples were subjected to SDS-PAGE. The membrane was blocked with 3% Milk. Ab171121 and ab181602 (Rabbit anti-GAPDH loading control) were incubated overnight at 4°C at 1/1000 dilution and 1/20000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20000 dilution for 1 hour at room temperature before imaging.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLO1 antibody [Glo1a] (ab171121)Immunohistochemical analysis of deparaffinized Human stomach cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.
-
All lanes : Anti-GLO1 antibody [Glo1a] (ab171121) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : HepG2 cell lysate
Lane 3 : 293T cell lysate
Lane 4 : A431 cell lysate
Lane 5 : A549 cell lysate
Lane 6 : MCF7 cell lysate
Lane 7 : U2OS cell lysate
Lane 8 : K562 cell lysate
Lane 9 : monkey COS7 cell lysate
Lane 10 : mouse MEF cell lysate
Lane 11 : mouse C2C12 cell lysate
Lane 12 : rat NRK cell lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : goat anti-mouse-HRP at 1/20000 dilution
Predicted band size: 21 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GLO1 antibody [Glo1a] (ab171121)Immunohistochemical analysis of deparaffinized Human prostate cancer tissue, labeling GLO1 with ab171121 at 1/800 dilution. Colorimetric detection was performed using metal enhanced DAB and tissues counterstained with hematoxylin.

