Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Complement Classical Pathway

Anti-GC1q R antibody (ab180756)

Anti-GC1q R antibody (ab180756)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to GC1q R
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-C3 antibody [11H9] (ab11862)
Product image
Anti-GC1q R antibody (ab37851)
Product image
Anti-C4a antibody [EPR10143] (ab170942)
Product image
Anti-GC1q R antibody [EPR23238-107] (ab270032)

Overview

  • Product name

    Anti-GC1q R antibody
    See all GC1q R primary antibodies
  • Description

    Rabbit polyclonal to GC1q R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, African green monkey
  • Immunogen

    Recombinant full length protein corresponding to Human GC1q R aa 74-282. Mature form.
    Sequence:

    LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRK VAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVI KNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTN YTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLE DLKSFVKSQ


    Database link: Q07021
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • CEM, SW620, HeLa, Jurkat, Mouse liver, Mouse kidney, Mouse heart and Mouse intestine cell lysates.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Innate Immunity
    • Complement
    • Classical Pathway
    • Microbiology
    • Interspecies Interaction
    • Host Virus Interaction

Images

  • Western blot - Anti-GC1q R antibody (ab180756)
    Western blot - Anti-GC1q R antibody (ab180756)
    All lanes : Anti-GC1q R antibody (ab180756) at 1/500 dilution

    Lane 1 : CEM cell lysate
    Lane 2 : SW620 cell lysate
    Lane 3 : HeLa cell lysate
    Lane 4 : Jurkat cell lysate
    Lane 5 : Mouse liver cell lysate
    Lane 6 : Mouse kidney cell lysate
    Lane 7 : Mouse heart cell lysate
    Lane 8 : Mouse intestine cell lysate

    Predicted band size: 31 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GC1q R antibody (ab180756)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GC1q R antibody (ab180756)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat lung tissue labelling GC1q R with ab180756 at 1/100. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GC1q R antibody (ab180756)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GC1q R antibody (ab180756)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophagus tissue labelling GC1q R with ab180756 at 1/100. Magnification: 400x.
  • Immunocytochemistry/ Immunofluorescence - Anti-GC1q R antibody (ab180756)
    Immunocytochemistry/ Immunofluorescence - Anti-GC1q R antibody (ab180756)
    Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab180756. Blue DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-GC1q R antibody (ab180756)

  •  
  • Product image

    Anti-GC1q R antibody [EPR8871] - BSA and Azide free (ab238965)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GC1q R antibody [EPR8871] (ab131284)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GC1q R antibody [EPR8870] (ab134926)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GC1q R antibody (ab101267)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-GC1q R antibody [60.11] (ab24733)

    Applications: Flow Cyt, ICC, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-ClC-2 antibody [EPR6492(2)] (ab154798)

  •  
  • Goat Anti-Dog IgM H&L (HRP) (ab112835)

  •  
  • Product image

    Human INVS (Inversin) knockout HEK-293T cell lysate (ab258471)

  •  
  • Cyanine5 NHS ester, Amine-reactive red emitting fluorescent dye. (ab146454)

  •  
  • Human GLP1R knockout SH-SY5Y cell line (ab280778)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.