Anti-GC1q R antibody (ab180756)
Key features and details
- Rabbit polyclonal to GC1q R
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-GC1q R antibody
See all GC1q R primary antibodies -
Description
Rabbit polyclonal to GC1q R -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human GC1q R aa 74-282. Mature form.
Sequence:LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRK VAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVI KNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTN YTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLE DLKSFVKSQ
Database link: Q07021 -
Positive control
- CEM, SW620, HeLa, Jurkat, Mouse liver, Mouse kidney, Mouse heart and Mouse intestine cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-GC1q R antibody (ab180756) at 1/500 dilution
Lane 1 : CEM cell lysate
Lane 2 : SW620 cell lysate
Lane 3 : HeLa cell lysate
Lane 4 : Jurkat cell lysate
Lane 5 : Mouse liver cell lysate
Lane 6 : Mouse kidney cell lysate
Lane 7 : Mouse heart cell lysate
Lane 8 : Mouse intestine cell lysate
Predicted band size: 31 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat lung tissue labelling GC1q R with ab180756 at 1/100. Magnification: 400x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophagus tissue labelling GC1q R with ab180756 at 1/100. Magnification: 400x.
-
Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab180756. Blue DAPI for nuclear staining.