Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-GBA antibody (ab55080)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-GBA antibody (ab55080)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to GBA
  • Suitable for: WB, IHC-P, ICC/IF
  • Knockout validated
  • Reacts with: Human
  • Isotype: IgG2a

You may also be interested in

Product image
Alexa Fluor® 594 Anti-ALDH1A1 antibody [EP1933Y] (ab206884)
Product image
HRP Anti-FUBP1/FBP antibody [EPR12326] (ab209049)
Product image
Anti-Cullin 3/CUL-3 antibody [EPR3196Y] (ab75851)
Product image
Human PDGFC knockout HeLa cell line (ab264740)

Overview

  • Product name

    Anti-GBA antibody
    See all GBA primary antibodies
  • Description

    Mouse monoclonal to GBA
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human GBA aa 146-236.
    Sequence:

    SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKL KIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Parkinson's disease
    • Other
    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Signal Transduction
    • Metabolism
    • Lipid metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Types of disease
    • Neurodegenerative disease
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-GBA antibody (ab55080)
    Western blot - Anti-GBA antibody (ab55080)

    Lane 1: Wild-type HAP1 whole cell lysate (40 µg)
    Lane 2: GBA knockout HAP1 whole cell lysate (40 µg)
    Lane 3: MCF7 whole cell lysate (40 µg)
    Lane 4: HepG2 whole cell lysate (40 µg) 

    Lanes 1 - 4: Merged signal (red and green). Green - ab55080 observed at 70 kDa. Red - loading control, ab181602, observed at 37 kDa. 

    ab55080 was shown to specifically react with GBA in wild-type HAP1 cells along with additional cross-reactive bands. No bands were observed when GBA knockout samples were used. Wild-type and GBA knockout samples were subjected to SDS-PAGE. Ab55080 and ab181602 (Rabbit anti GAPDH loading control) were incubated overnight at 4°C at 1 ug/ml and 1/10,000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed (ab216772) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) secondary antibodies at 1/10,000 dilution for 1 hour at room temperature before imaging.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-GBA antibody (ab55080)
    Immunocytochemistry/ Immunofluorescence - Anti-GBA antibody (ab55080)

    ab55080 at 10 ug/ml staining GBA in human Hela cells by Immunocytochemistry/ Immunofluorescence.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-GBA antibody (ab55080)
    Western blot - Anti-GBA antibody (ab55080)

    GBA antibody (ab55080) at 1ug/lane + MCF-7 cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBA antibody (ab55080)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GBA antibody (ab55080)

    GBA antibody (ab55080) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human breast cancer.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-GBA antibody (ab55080)
    Western blot - Anti-GBA antibody (ab55080) This image is a courtesy of Anonymous Abreview
    All lanes : Anti-GBA antibody (ab55080) at 1/1000 dilution

    Lane 1 : Lysate prepared from MOCK
    Lane 2 : Lysate prepared from human HN10 cells

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : IRDye® donkey polyclonal to mouse IgG at 1/3000 dilution

    Performed under reducing conditions.

    Predicted band size: 60 kDa
    Observed band size: 60 kDa


    Exposure time: 1 minute


    This image was generated using the ascites version of the product.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-GBA antibody (ab55080)

  •  
  • Product image

    Biotin Anti-GBA antibody [EPR5142] (ab201496)

    Applications: IHC-P

  •  
  • Product image

    Anti-GBA antibody [EPR5143(3)] (ab128879)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GBA antibody [EPR5142] (ab125065)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GBA antibody [EPR5142] - BSA and Azide free (ab215261)

    Applications: IHC-P, WB

  •  
  • Product image

    HRP Anti-GBA antibody [EPR5142] (ab200856)

    Applications: WB

  •  
  • Product image

    Anti-GBA antibody (ab88300)

    Applications: WB

  •  
  • Product image

    Anti-GBA antibody [EPR5143(3)] - BSA and Azide free (ab215260)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GBA antibody (ab96256)

    Applications: WB

  •  
  • Product image

    Anti-GBA antibody (ab96246)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-p53 antibody [X77] (ab16465)

  •  
  • Product image

    Anti-Peripherin antibody [8G2] (ab4653)

  •  
  • Product image

    Anti-FLIP antibody (ab233230)

  •  
  • Product image

    Human MSL1 knockout HeLa cell lysate (ab258973)

  •  
  • Rat wild-type PC-12 cell line (ab279978)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.