Anti-GBA antibody (ab55080)
Key features and details
- Mouse monoclonal to GBA
- Suitable for: WB, IHC-P, ICC/IF
- Knockout validated
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-GBA antibody
See all GBA primary antibodies -
Description
Mouse monoclonal to GBA -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB Human -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human GBA aa 146-236.
Sequence:SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKL KIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
-
General notes
This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Lane 1: Wild-type HAP1 whole cell lysate (40 µg)
Lane 2: GBA knockout HAP1 whole cell lysate (40 µg)
Lane 3: MCF7 whole cell lysate (40 µg)
Lane 4: HepG2 whole cell lysate (40 µg)Lanes 1 - 4: Merged signal (red and green). Green - ab55080 observed at 70 kDa. Red - loading control, ab181602, observed at 37 kDa.
ab55080 was shown to specifically react with GBA in wild-type HAP1 cells along with additional cross-reactive bands. No bands were observed when GBA knockout samples were used. Wild-type and GBA knockout samples were subjected to SDS-PAGE. Ab55080 and ab181602 (Rabbit anti GAPDH loading control) were incubated overnight at 4°C at 1 ug/ml and 1/10,000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed (ab216772) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) secondary antibodies at 1/10,000 dilution for 1 hour at room temperature before imaging.
This image was generated using the ascites version of the product.
-
ab55080 at 10 ug/ml staining GBA in human Hela cells by Immunocytochemistry/ Immunofluorescence.
This image was generated using the ascites version of the product.
-
GBA antibody (ab55080) at 1ug/lane + MCF-7 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
GBA antibody (ab55080) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human breast cancer.
This image was generated using the ascites version of the product.
-
All lanes : Anti-GBA antibody (ab55080) at 1/1000 dilution
Lane 1 : Lysate prepared from MOCK
Lane 2 : Lysate prepared from human HN10 cells
Lysates/proteins at 10 µg per lane.
Secondary
All lanes : IRDye® donkey polyclonal to mouse IgG at 1/3000 dilution
Performed under reducing conditions.
Predicted band size: 60 kDa
Observed band size: 60 kDa
Exposure time: 1 minuteThis image was generated using the ascites version of the product.

