Anti-FUT4 antibody [6B11B4] (ab181461)
Key features and details
- Mouse monoclonal [6B11B4] to FUT4
- Suitable for: WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2b
Overview
-
Product name
Anti-FUT4 antibody [6B11B4]
See all FUT4 primary antibodies -
Description
Mouse monoclonal [6B11B4] to FUT4 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human FUT4 aa 199-302. (Expressed in E.coli).
Sequence:GGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPD WPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFE SPSH
Database link: P22083 -
Positive control
- Jurkat cell lysate; FUT4 (AA: 199-302)-hIgGFc transfected HEK293 cell lysate; FUT4 recombinant protein.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR170435-13 are from Tissue Culture Supernatant
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6B11B4 -
Isotype
IgG2b -
Research areas
Images
-
Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution + Jurkat cell lysate
Predicted band size: 59 kDa
-
All lanes : Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : FUT4 (Amino acids: 199-302)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 59 kDa
-
Anti-FUT4 antibody [6B11B4] (ab181461) at 1/500 dilution + FUT4 recombinant protein
Predicted band size: 59 kDaExpected MWt is 37 kDa.

