Anti-FLCN antibody (ab176707)
Key features and details
- Rabbit polyclonal to FLCN
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FLCN antibody
See all FLCN primary antibodies -
Description
Rabbit polyclonal to FLCN -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P Human -
Immunogen
Synthetic peptide within Human FLCN aa 1-50 (N terminal). The exact sequence is proprietary. NP_659434.2 .
Sequence:MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEG
Database link: Q8NFG4 -
Positive control
- Human linitis plastica stomach cancer and Human ovarian carcinoma tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176707 was affinity purified using an epitope specific to FLCN immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FLCN antibody (ab176707)
Immunohistochemical analysis of paraffin embedded Human linitis plastica stomach cancer tissue labeling FLCN with ab176707 at 1/250 dilution, followed by DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FLCN antibody (ab176707)
Immunohistochemical analysis of paraffin embedded Human ovarian carcinoma tissue labeling FLCN with ab176707 at 1/250 dilution, followed by DAB staining.