Anti-EXOSC9 antibody (ab156686)
Key features and details
- Rabbit polyclonal to EXOSC9
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-EXOSC9 antibody
See all EXOSC9 primary antibodies -
Description
Rabbit polyclonal to EXOSC9 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
-
Immunogen
Synthetic peptide corresponding to Human EXOSC9 aa 389-439.
Sequence:IILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAA N
Database link: NP_005024.2 -
Positive control
- 293T, HeLa, NIH3T3 and Jurkat whole cell lysate (ab7899).
-
General notes
This product was previously labelled as Exosome Component 9
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab156686 was affinity purified using an epitope specific to EXOSC9 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-EXOSC9 antibody (ab156686)All lanes : Anti-EXOSC9 antibody (ab156686) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 49 kDa
Exposure time: 10 seconds
-
Western blot - Anti-EXOSC9 antibody (ab156686)All lanes : Anti-EXOSC9 antibody (ab156686) at 0.4 µg/ml
Lane 1 : Mouse NIH3T3 whole cell lysate at 50 µg
Lane 2 : Mouse NIH3T3 whole cell lysate at 15 µg
Developed using the ECL technique.
Predicted band size: 49 kDa
Exposure time: 3 seconds
-
Immunoprecipitation - Anti-EXOSC9 antibody (ab156686)Detection of EXOSC9 by Western Blot of Immunoprecipitate.
Immunoprecipitation of 293T whole cell lysate using ab156686 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane) followed by detection 9 with ab156686 at 0.4 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection: Chemiluminescence with exposure time of 3 seconds.
