Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Immune System Diseases Autoimmune

Anti-EXOSC9 antibody (ab156686)

Price and availability

284 784 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-EXOSC9 antibody (ab156686)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to EXOSC9
  • Suitable for: WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-AGE antibody (ab23722)
Product image
Anti-CILP antibody [EPR16303] - BSA and Azide free (ab251162)
Product image
Anti-CHD4 antibody [EPR12229] (ab181370)
Product image
Anti-CHD4 antibody [3F2/4] (ab70469)

Overview

  • Product name

    Anti-EXOSC9 antibody
    See all EXOSC9 primary antibodies
  • Description

    Rabbit polyclonal to EXOSC9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human EXOSC9 aa 389-439.
    Sequence:

    IILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAA N


    Database link: NP_005024.2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, NIH3T3 and Jurkat whole cell lysate (ab7899).
  • General notes

     This product was previously labelled as Exosome Component 9

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab156686 was affinity purified using an epitope specific to EXOSC9 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Immune System Diseases
    • Autoimmune
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • Other

Images

  • Western blot - Anti-EXOSC9 antibody (ab156686)
    Western blot - Anti-EXOSC9 antibody (ab156686)
    All lanes : Anti-EXOSC9 antibody (ab156686) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 10 seconds
  • Western blot - Anti-EXOSC9 antibody (ab156686)
    Western blot - Anti-EXOSC9 antibody (ab156686)
    All lanes : Anti-EXOSC9 antibody (ab156686) at 0.4 µg/ml

    Lane 1 : Mouse NIH3T3 whole cell lysate at 50 µg
    Lane 2 : Mouse NIH3T3 whole cell lysate at 15 µg

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 3 seconds
  • Immunoprecipitation - Anti-EXOSC9 antibody (ab156686)
    Immunoprecipitation - Anti-EXOSC9 antibody (ab156686)

    Detection of EXOSC9 by Western Blot of Immunoprecipitate.
    Immunoprecipitation of 293T whole cell lysate using ab156686 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane) followed by detection 9 with ab156686 at 0.4 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection: Chemiluminescence with exposure time of 3 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-EXOSC9 antibody (ab156686)

  •  
  • Product image

    Anti-EXOSC9 antibody [2337C3a] (ab54283)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PARIS antibody (ab130867)

  •  
  • Donkey Anti-Mouse IgG H&L (ab6707)

  •  
  • Product image

    Anti-EAAT1 antibody (ab235203)

  •  
  • Product image

    Anti-CHST9 antibody (ab129779)

  •  
  • Product image

    Anti-MYLPF antibody (ab214313)

  •  
  • Product image

    Anti-PDE9A antibody (ab168432)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.