Anti-EGR2 antibody [OTI1F10] (ab156765)
Key features and details
- Mouse monoclonal [OTI1F10] to EGR2
- Suitable for: WB, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG2b
Overview
-
Product name
Anti-EGR2 antibody [OTI1F10]
See all EGR2 primary antibodies -
Description
Mouse monoclonal [OTI1F10] to EGR2 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey
Predicted to work with: Pig
-
Immunogen
Recombinant fragment corresponding to Human EGR2 aa 156-476. (NP_000390) produced in E.coli.
Sequence:QTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPP PSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDT LRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAA AAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSD ELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGR KFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCS SNSSSLGGGPLAPCSSRTRTP
Database link: P11161-1 -
Positive control
- ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY EGR2. WB: Recombinant Human EGR2 protein (ab132968), pCMV6-ENTRY EGR2 cDNA transfected HEK-293T cell lysate.
-
General notes
The clone number has been updated from 1F10 to OTI1F10, both clone numbers name the same clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 50% Glycerol, PBS -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI1F10 -
Isotype
IgG2b -
Research areas
Images
-
All lanes : Anti-EGR2 antibody [OTI1F10] (ab156765) at 1/500 dilution
Lane 1 : pCMV6-ENTRY EGR2 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : pCMV6-ENTRY control cDNA transfected HEK-293T cell lysate
Lysates/proteins at 5 µg per lane.
Predicted band size: 50.1 kDa
-
pCMV6-ENTRY EGR2 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for EGR2 using ab156765 at a 1/100 dilution in ICC/IF.

