Anti-DNAJC2/ZRF1 antibody (ab134572)
Key features and details
- Rabbit polyclonal to DNAJC2/ZRF1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-DNAJC2/ZRF1 antibody
See all DNAJC2/ZRF1 primary antibodies -
Description
Rabbit polyclonal to DNAJC2/ZRF1 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide corresponding to Human DNAJC2/ZRF1 aa 500-550.
Sequence:IGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSERFEGPYT D
Database link: NP_055192.1 -
General notes
This product was previously labelled as DNAJC2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8. -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab134572 was affinity purified using an epitope specific to DNAJC2/ZRF1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-DNAJC2/ZRF1 antibody (ab134572) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH 3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 71 kDa
Exposure time: 10 seconds
-
Detection of DNAJC2/ZRF1 by Western Blot of Immunprecipitate.
Immunoprecipitation of HeLa whole cell lysate using ab134572 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane) followed by detection of DNAJC2/ZRF1 with ab134572 at 1µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection: Chemiluminescence with exposure time of 3 seconds.

