Recombinant human FKBP2 protein (ab93681)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human FKBP2 protein
See all FKBP2 proteins and peptides -
Biological activity
Specific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.Activity Assay
- Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
- Add 10 µl of recombinant FKBP2 protein with 1 µg in assay buffer.
- Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
- Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
- Record the increase in A405 nm for 30 minutes at 25°C.
-
Purity
> 90 % SDS-PAGE.
ab93681 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK IPGGATLVFEVELLKIERRTEL
-
Preparation and Storage
- 13 kDa FK506-binding protein
- 13 kDa FKBP
- EC 5.2.1.8
Images
-
SDS-PAGE - Recombinant human FKBP2 protein (ab93681)15% SDS-PAGE analysis of ab93681 (3µg).
