Anti-DNA Polymerase iota antibody [OTI1H9] (ab157244)
Key features and details
- Mouse monoclonal [OTI1H9] to DNA Polymerase iota
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-DNA Polymerase iota antibody [OTI1H9]
See all DNA Polymerase iota primary antibodies -
Description
Mouse monoclonal [OTI1H9] to DNA Polymerase iota -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human DNA Polymerase iota aa 458-740. (NP_009126) produced in E.coli.
Sequence:STTSRSGKHSFKMKDTHMEDFPKDKETNRDFLPSGRIESTRTRESPLDTT NFSKEKDINEFPLCSLPEGVDQEVFKQLPVDIQEEILSGKSREKFQGKGS VSCPLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPCEPGTSGF NSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQGFHFTNSNPAVSAFH SFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSD IDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK
Database link: Q9UNA4 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY DNA Polymerase iota cDNA.
-
General notes
The clone number has been updated from 1H9 to OTI1H9, both clone numbers name the same clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1H9 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-DNA Polymerase iota antibody [OTI1H9] (ab157244) at 1/2000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY DNA Polymerase iota cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 83 kDa