Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Blood Serum Proteins

Anti-DMT1 antibody (ab55735)

Price and availability

381 945 ₸

Availability

Order now and get it on Friday March 05, 2021

Anti-DMT1 antibody (ab55735)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to DMT1
  • Suitable for: Flow Cyt, IHC-P, IHC-Fr, WB
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2a

You may also be interested in

Product image
Anti-alpha 2 Macroglobulin antibody [EPR4432] (ab109422)
Product image
Human Ficolin-2 Antibody Pair - BSA and Azide free (ab253446)
Product image
Anti-Antithrombin III/ATIII antibody (ab231005)
Product image
Anti-beta 2 Microglobulin antibody - BSA and Azide free (Detector) (ab255614)

Overview

  • Product name

    Anti-DMT1 antibody
    See all DMT1 primary antibodies
  • Description

    Mouse monoclonal to DMT1
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    IHC-P
    Human
    WB
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human DMT1 aa 1-65.
    Sequence:

    MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATY FNEKISIPEEEYSCF


    Database link: P49281
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human endometrium cance Flow cyt: SH-SY5Y cells
  • General notes

    This product was changed from ascites to tissue culture supernatant on 17/04/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.40
    Constituents: 8% Sodium chloride, 0.2% Monobasic dihydrogen potassium phosphate, 0.2% Potassium chloride, 0.6% Dibasic monohydrogen sodium phosphate, 91% Water
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Cardiovascular
    • Blood
    • Serum Proteins
    • Signal Transduction
    • Metabolism
    • Plasma Membrane
    • Channels
    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals

Images

  • Western blot - Anti-DMT1 antibody (ab55735)
    Western blot - Anti-DMT1 antibody (ab55735)

    Western blot against tagged recombinant protein fragment (immunogen peptide) using ab55735 DMT1 antibody at 1ug/ml. Predicted band size of immunogen is 33 kDa.

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Frozen sections) - Anti-DMT1 antibody (ab55735)
    Immunohistochemistry (Frozen sections) - Anti-DMT1 antibody (ab55735) This image is courtesy of an abreview submitted by Dr. Ruma Raha-Chowdhury, Cambridge University, United Kingdom.

    IHC-Fr image of DMT1 staining on mouse duodenum using ab55735 (1:1000). The sections were fixed with paraformaldehyde and permeabilized using 0.1% TritonX in 0.1% PBS. The slides were blocked using 10 % donkey serum for 1 hour at 24°C. ab55735 was diluted 1:1000 using 0.1% TritonX with 0.1x PBS- 10% Donkeys and incubated with the slides at 4°C for 24 hours. The secondary antibody used was donkey polyclonal against mouse IgG conjugated to Alexa Fluor 568 (1:1000)

    This image was generated using the ascites version of the product.

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DMT1 antibody (ab55735)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-DMT1 antibody (ab55735)

    DMT1 antibody (ab55735) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human endometrium cancer.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-DMT1 antibody (ab55735)
    Flow Cytometry - Anti-DMT1 antibody (ab55735)

    Overlay histogram showing SH-SY5Y cells stained with ab55735 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55735, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-DMT1 antibody (ab55735)

  •  
  • Product image

    Anti-DMT1 antibody (ab262932)

    Applications: ICC/IF, IHC-P

  •  
  • Product image

    Anti-DMT1 antibody (ab133402)

    Applications: IHC-P

  •  
  • Product image

    Anti-DMT1 antibody (ab140977)

    Applications: IHC-P

  •  
  • Product image

    Anti-DMT1 antibody (ab55812)

    Applications: WB

  •  
  • Product image

    Anti-DMT1 antibody (ab262715)

    Applications: WB

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.