Anti-DMT1 antibody (ab55735)
Key features and details
- Mouse monoclonal to DMT1
- Suitable for: Flow Cyt, IHC-P, IHC-Fr, WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-DMT1 antibody
See all DMT1 primary antibodies -
Description
Mouse monoclonal to DMT1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanIHC-P HumanWB Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human DMT1 aa 1-65.
Sequence:MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATY FNEKISIPEEEYSCF
Database link: P49281 -
Positive control
- IHC-P: Human endometrium cance Flow cyt: SH-SY5Y cells
-
General notes
This product was changed from ascites to tissue culture supernatant on 17/04/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituents: 8% Sodium chloride, 0.2% Monobasic dihydrogen potassium phosphate, 0.2% Potassium chloride, 0.6% Dibasic monohydrogen sodium phosphate, 91% Water -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Western blot against tagged recombinant protein fragment (immunogen peptide) using ab55735 DMT1 antibody at 1ug/ml. Predicted band size of immunogen is 33 kDa.
This image was generated using the ascites version of the product.
-
IHC-Fr image of DMT1 staining on mouse duodenum using ab55735 (1:1000). The sections were fixed with paraformaldehyde and permeabilized using 0.1% TritonX in 0.1% PBS. The slides were blocked using 10 % donkey serum for 1 hour at 24°C. ab55735 was diluted 1:1000 using 0.1% TritonX with 0.1x PBS- 10% Donkeys and incubated with the slides at 4°C for 24 hours. The secondary antibody used was donkey polyclonal against mouse IgG conjugated to Alexa Fluor 568 (1:1000)
This image was generated using the ascites version of the product.
-
DMT1 antibody (ab55735) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human endometrium cancer.
This image was generated using the ascites version of the product.
-
Overlay histogram showing SH-SY5Y cells stained with ab55735 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55735, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.