Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Microbiology Interspecies Interaction Host Virus Interaction

Anti-Cyclin T1 antibody (ab176702)

Anti-Cyclin T1 antibody (ab176702)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Cyclin T1
  • Suitable for: IP, WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-NR5A2 / LRH1 antibody (ab219603)
Product image
Anti-TCTEX-1 antibody [EPR17294] (ab202583)
Product image
Anti-NR5A2 / LRH1 antibody (ab223211)
Product image
Anti-VPRBP antibody [EPR16012] - BSA and Azide free (ab251381)

Overview

  • Product name

    Anti-Cyclin T1 antibody
    See all Cyclin T1 primary antibodies
  • Description

    Rabbit polyclonal to Cyclin T1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human Cyclin T1 aa 625-675. The exact sequence is proprietary.
    Sequence:

    FSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQ P


    Database link: O60563
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa and 293T whole cell lysates; IPL HeLa whole cell lysate; IHC-P: Human breast carcinoma tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Microbiology
    • Interspecies Interaction
    • Host Virus Interaction
    • Cell Biology
    • Cell Cycle
    • Cyclins
    • Other Cyclins
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Cyclins
    • Other Cyclins
    • Immunology
    • Immune System Diseases
    • Antiviral Signaling
    • HIV-related

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin T1 antibody (ab176702)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin T1 antibody (ab176702)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast carcinoma tissue labelling Cyclin T1 with ab 176702 at 1 µg/mL.
  • Western blot - Anti-Cyclin T1 antibody (ab176702)
    Western blot - Anti-Cyclin T1 antibody (ab176702)
    All lanes : Anti-Cyclin T1 antibody (ab176702) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg

    Predicted band size: 81 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation - Anti-Cyclin T1 antibody (ab176702)
    Immunoprecipitation - Anti-Cyclin T1 antibody (ab176702)

    Detection of Cyclin T1 by Western Blot of Immunprecipitate.


    Lane 1: ab176702 at 0.04µg/ml labeling Cyclin T1 in HeLa whole cell lysate immunoprecipitated using ab176702 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane). Lane 2: Control IgG
    Detection: Chemiluminescence with exposure time of 3 seconds.

     

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Cyclin T1 antibody (ab176702)

  •  
  • Product image

    Anti-Cyclin T1 antibody [EPR17982] - BSA and Azide free (ab238940)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Cyclin T1 antibody [EPR17982] (ab184703)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Cyclin T1 antibody (ab226851)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Cyclin T1 antibody (ab264326)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Cyclin T1 antibody (ab225872)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Cyclin T1 antibody (ab264325)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-Cyclin T1 antibody (ab2098)

    Applications: IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-Cyclin T1 antibody [EPR17982] (ab225325)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-Cyclin T1 antibody (ab27963)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Tau antibody [EPR22524-95] (ab254256)

  •  
  • Product image

    Anti-IRAK4 antibody [Y279] (ab32511)

  •  
  • Product image

    Anti-FOXP2 antibody (ab16046)

  •  
  • Product image

    Anti-PAX8 antibody (ab97477)

  •  
  • Product image

    Anti-DMT1 antibody (ab55735)

  •  
  • Product image

    Anti-IRAK-1 antibody (ab238)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.