Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Cell cycle Cyclins

Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

Price and availability

314 937 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [DCS2.2] to Cyclin D3/CCND3
  • Suitable for: Flow Cyt, WB, IHC-P
  • Knockout validated
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Recombinant Human Cyclin C protein (ab59893)
Product image
Recombinant human CDK1 + Cyclin B1 protein (Active) (ab271456)
Product image
Anti-Cyclin A2 antibody (ab137769)
Product image
Alexa Fluor® 594 Anti-Cyclin A2 antibody [EPR17351] (ab217226)

Overview

  • Product name

    Anti-Cyclin D3/CCND3 antibody [DCS2.2]
    See all Cyclin D3/CCND3 primary antibodies
  • Description

    Mouse monoclonal [DCS2.2] to Cyclin D3/CCND3
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human Cyclin D3/CCND3.
    Sequence:

    MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQR EIKPHMRKML AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQ LQLLGAVCMLLASKLRETTPLT IEKLCIYTDHAVSPRQLRDWEVLVLG KLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK HAQTFLALCATDYT FAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL RA CQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL


    Database link: P30281
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa, K562, HAP1, HEK-293T and Jurkat cell lysates. Flow Cyt: HeLa cells. IHC-P: Human pancreas tissue.
  • General notes

     This product was previously labelled as Cyclin D3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.08% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    DCS2.2
  • Isotype

    IgG1
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cyclins
    • Cell Biology
    • Cell Cycle
    • Cyclins
    • Cyclin D Family
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Cyclins
    • Cyclin D Family
    • Cancer
    • Cell cycle
    • Cyclins
    • Cyclin D family

Images

  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    All lanes : Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283) at 1/1000 dilution

    Lane 1 : Wild-type HeLa cell lysate
    Lane 2 : CCND3 knockout HeLa cell lysate
    Lane 3 : Jurkat cell lysate
    Lane 4 : HEK-293 cell lysate

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) at 1/10000 dilution

    Predicted band size: 35 kDa
    Observed band size: 35 kDa



    Lanes 1-4: Merged signal (red and green). Green - ab28283 observed at 35 kDa. Red - loading control ab52901.

     ab28283 Anti-Cyclin D3/CCND3 antibody [DCS2.2]  was shown to specifically react with Cyclin D3 in wild-type HeLa cells. Loss of signal was observed when knockout cell line ab264931 (knockout cell lysate ab257876) was used. Wild-type and Cyclin D3 knockout samples were subjected to SDS-PAGE. ab28283 and Anti-beta Tubulin [EP1331Y] - Microtubule Marker (ab52901) were incubated at room temperature for 2.5 hours at 1 in 1000 dilution and 1 in 20000 dilution respectively. Blots were developed with Goat anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) and Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) secondary antibodies at 1 in 20000 dilution for 1 hour at room temperature before imaging.

  • Flow Cytometry - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Flow Cytometry - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

    Overlay histogram showing HeLa cells stained with ab28283 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab28283, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was a goat anti-mouse DyLight® 488 (IgG; H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

    ab28283 (4µg/ml) staining Cyclin D3/CCND3 in human pancreas, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong nuclear staining.
    Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer citrate pH6.1 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

    Lane 1: Wild-type HAP1 whole cell lysate (20 µg)
    Lane 2: Cyclin D3/CCND3 (KO) knockout HAP1 whole cell lysate (20 µg)
    Lane 3: HEK293 whole cell lysate (20 µg)
    Lane 4: Jurkat whole cell lysate (20 µg)
    Lanes 1 - 4: Merged signal (red and green). Green - ab28283 observed at 33 kDa. Red - loading control, ab176560, observed at 50 kDa.

    ab28283 was shown to specifically recognize CCND3 in wild-type HAP1 cells along with additional cross reactive bands. No bands was observed when CCND3 knockout samples were uexamined. Wild-type and CCND3 knockout samples were subjected to SDS-PAGE. Ab28283 and ab176560 (Rabbit anti alpha Tubulin loading control) were incubated overnight at 4°C at 1 ug/ml and 1/10,000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20,000 dilution for 1 hour at room temperature before imaging.

  • Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    Western blot - Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)
    All lanes : Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Nuclear Lysate
    Lane 2 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 3 : K562 (Human erythromyeloblastoid leukemia cell line) Whole Cell Lysate

    Lysates/proteins at 10 µg per lane.

    Secondary
    All lanes : Goat polyclonal to Mouse IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 35 kDa
    Observed band size: 35 kDa
    Additional bands at: 75 kDa. We are unsure as to the identity of these extra bands.


    Exposure time: 8 minutes

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Cyclin D3/CCND3 antibody [DCS2.2] (ab28283)

  •  
  • Product image

    Anti-Cyclin D3/CCND3 antibody (ab155682)

    Applications: ICC/IF, IHC-P

  •  
  • Product image

    Anti-Cyclin D3/CCND3 antibody (ab112034)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Cyclin D3/CCND3 antibody [SP207] - BSA and Azide free (ab245734)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-Cyclin D3/CCND3 (phospho T283) antibody (ab55322)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Cyclin D3/CCND3 antibody [SP207] (ab183338)

    Applications: Flow Cyt, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-c-Myc antibody [8] (ab17355)

  •  
  • Product image

    Anti-Nucleoside-diphosphate kinase antibody (ab228609)

  •  
  • Product image

    Anti-NFAT2 antibody (ab175134)

  •  
  • Product image

    Human Histone H3 (di methyl K4) peptide (ab7768)

  •  
  • Synthetic Human SDF1 protein (Biotin) (ab176086)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.