Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
Key features and details
- Mouse monoclonal [7E1B11] to CD90 / Thy1
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Rat, Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-CD90 / Thy1 antibody [7E1B11]
See all CD90 / Thy1 primary antibodies -
Description
Mouse monoclonal [7E1B11] to CD90 / Thy1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment corresponding to Human CD90/ Thy1 aa 17-132. (Expressed in E.coli).
Sequence:SRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGT VGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPIS SQNVTVLRDKLVKCEG
Database link: P04216 -
Positive control
- CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate; Human CD90 / Thy1 recombinant protein; T47D, HepG2 and PC-12 cell lysates; HeLa cells; Human endometrial cancer and cerebellum tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
7E1B11 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.
-
All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution
Lane 1 : T47D cell lysate
Lane 2 : HepG2 cell lysate
Lane 3 : PC-12 cell lysate
Predicted band size: 17 kDa
-
Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution + CD90 / Thy1 recombinant protein
Predicted band size: 17 kDaExpected MWt is 38.5 kDa.
-
All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution
Lane 1 : Non-transfected HEK293 cell lysate
Lane 2 : CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 17 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
Immunohistochemical analysis of paraffin-embedded Human endometrial cancer tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.
-
Immunofluorescent analysis of HeLa cells labeling CD90 / Thy1 with ab181469 at 1/200 dilution (red). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.