Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Adaptive Immunity T Cells CD

Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

Price and availability

268 032 ₸

Availability

Order now and get it on Friday March 05, 2021

Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [7E1B11] to CD90 / Thy1
  • Suitable for: WB, ICC/IF, IHC-P
  • Reacts with: Rat, Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Human ZAP70 knockout HeLa cell line (ab265522)
Product image
FITC Anti-CD4 antibody [RPA-T4] (ab86886)
Product image
Anti-CD80 antibody - BSA and Azide free (Detector) (ab259572)
Product image
Anti-CD19 antibody (ab99965)

Overview

  • Product name

    Anti-CD90 / Thy1 antibody [7E1B11]
    See all CD90 / Thy1 primary antibodies
  • Description

    Mouse monoclonal [7E1B11] to CD90 / Thy1
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human CD90/ Thy1 aa 17-132. (Expressed in E.coli).
    Sequence:

    SRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGT VGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPIS SQNVTVLRDKLVKCEG


    Database link: P04216
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate; Human CD90 / Thy1 recombinant protein; T47D, HepG2 and PC-12 cell lysates; HeLa cells; Human endometrial cancer and cerebellum tissues.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7E1B11
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Adaptive Immunity
    • T Cells
    • CD
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Synapse marker
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • B Lymphocytic Lineage
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • T Lymphocytic Lineage
    • Stem Cells
    • Hematopoietic Progenitors
    • Myeloid
    • Monocytic Lineage

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

    Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution

    Lane 1 : T47D cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : PC-12 cell lysate

    Predicted band size: 17 kDa

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution + CD90 / Thy1 recombinant protein

    Predicted band size: 17 kDa



    Expected MWt is 38.5 kDa.

  • Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Western blot - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    All lanes : Anti-CD90 / Thy1 antibody [7E1B11] (ab181469) at 1/500 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : CD90 / Thy1 (aa 17-132)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 17 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

    Immunohistochemical analysis of paraffin-embedded Human endometrial cancer tissue labeling CD90 / Thy1 with ab181469 at 1/200 dilution with DAB staining.

  • Immunocytochemistry/ Immunofluorescence - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)
    Immunocytochemistry/ Immunofluorescence - Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

    Immunofluorescent analysis of HeLa cells labeling CD90 / Thy1 with ab181469 at 1/200 dilution (red). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-CD90 / Thy1 antibody [7E1B11] (ab181469)

  •  
  • Product image

    Anti-CD90 / Thy1 antibody [EPR3132] - BSA and Azide free (ab181885)

    Applications: IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 594 Anti-CD90 / Thy1 antibody [EPR3133] (ab202512)

    Applications: ICC/IF

  •  
  • Product image

    Alexa Fluor® 647 Anti-CD90 / Thy1 antibody [EPR3133] (ab202334)

    Applications: ICC/IF

  •  
  • Product image

    Alexa Fluor® 568 Anti-CD90 / Thy1 antibody [EPR3133] (ab201848)

    Applications: ICC/IF

  •  
  • Product image

    Anti-CD90 / Thy1 antibody [EPR3132] (ab92574)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-CD90 / Thy1 antibody [EPR3133] (ab133350)

    Applications: ICC, IHC-P, WB

  •  
  • Product image

    Anti-CD90 / Thy1 antibody [EPR3133] - BSA and Azide free (ab226123)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 555 Anti-CD90 / Thy1 antibody [EPR3133] (ab202511)

    Applications: ICC/IF

  •  
  • Product image

    Anti-CD90 / Thy1 antibody [EPR3133] - Low endotoxin, Azide free (ab216449)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Human Neuron specific Enolase ELISA Kit (ab217778)

  •  
  • Product image

    Anti-MEK1 antibody [32G3] (ab70833)

  •  
  • Product image

    Recombinant human TIE2 (mutated R915C) protein (Active) (ab269048)

  •  
  • Product image

    Recombinant Human c-Myc protein (Tagged) (ab235798)

  •  
  • Fenbufen, COX inhibitor (ab142875)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.