Anti-CCT3 antibody (ab176686)
Key features and details
- Rabbit polyclonal to CCT3
- Suitable for: IP, WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-CCT3 antibody
See all CCT3 primary antibodies -
Description
Rabbit polyclonal to CCT3 -
Host species
Rabbit -
Tested applications
Suitable for: IP, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Synthetic peptide within Human CCT3 aa 495-545. The exact sequence is proprietary. (NP_005989.3).
Sequence:IWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQ E
Database link: P49368 -
Positive control
- WB: HeLa, Jurkat, 293T and Mouse NIH3T3 cell lysates. IP: HeLa whole cell lysate. IHC-P: Human lung carcinoma; mouse teratoma.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunoprecipitation - Anti-CCT3 antibody (ab176686)
Detection of Human CCT3 in Immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176686 at 6 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection. Detection: Chemiluminescence with an exposure time of 3 seconds.
-
Western blot - Anti-CCT3 antibody (ab176686)All lanes : Anti-CCT3 antibody (ab176686) at 0.04 µg/ml
Lane 1 : HeLa cell lysate at 50 µg
Lane 2 : HeLa cell lysate at 15 µg
Lane 3 : 293T cell lysate at 50 µg
Lane 4 : Jurkat cell lysate at 50 µg
Lane 5 : Mouse NIH3T3 cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 61 kDa
Exposure time: 3 seconds
