Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)

Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Carbonic Anhydrase 3/CA3
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Soluble TNF Receptor I antibody - BSA and Azide free (Detector) (ab242762)
Desalting Spin Columns (ab270693)
Product image
Anti-HRG antibody (ab230995)
Product image
Recombinant Human RRAGC protein (ab123171)

Overview

  • Product name

    Anti-Carbonic Anhydrase 3/CA3 antibody
    See all Carbonic Anhydrase 3/CA3 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 3/CA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Horse, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Carbonic Anhydrase 3/CA3 aa 1-260.
    Sequence:

    MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVS YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI NNRVVRASFK


    Database link: P07451
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Recombinant Human Carbonic Anhydrase 3/CA3 protein (BSA and azide free) (ab173078) can be used as a positive control in WB. HeLa and 293 cell lysate.
  • General notes

     This product was previously labelled as Carbonic Anhydrase III

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Hypoxia
    • Associated Proteins
    • Tags & Cell Markers
    • Cell Type Markers
    • Other Cell Types
    • Cell Biology
    • Other Antibodies
    • Other Antibodies

Images

  • Western blot - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
    Western blot - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
    All lanes : Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : 293 cell lysate

    Predicted band size: 30 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling Carbonic Anhydrase 3/CA3 with ab175309 at 1/200. Magnification: 200x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling Carbonic Anhydrase 3/CA3 with ab175309 at 1/200. Magnification: 400x.

  • Immunocytochemistry/ Immunofluorescence - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
    Immunocytochemistry/ Immunofluorescence - Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)
    Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175309. Blue DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309)

  •  
  • Product image

    Anti-Carbonic Anhydrase 3/CA3 antibody (ab196835)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Carbonic Anhydrase 3/CA3 antibody [EPR13425] (ab181358)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Carbonic Anhydrase 3/CA3 antibody [C2] (ab239504)

    Applications: WB

  •  
  • Product image

    Anti-Carbonic Anhydrase 3/CA3 antibody (ab150037)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Alexa Fluor® 647 Anti-Rel B antibody [EP613Y] (ab199509)

  •  
  • Product image

    Anti-p57 Kip2 (phospho T310) antibody (ab61064)

  •  
  • Product image

    Anti-p60 CAF1/MPP7 antibody (ab72519)

  •  
  • Product image

    Anti-FGFR2 antibody [EPR24679-79] (ab281925)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.