Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Binding Proteins

Anti-CAPZA2 antibody (ab175378)

Anti-CAPZA2 antibody (ab175378)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to CAPZA2
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Caldesmon/CDM antibody [h-CALD] (ab233987)
Product image
Anti-Plastin L antibody [EPR4277] - BSA and Azide free (ab247772)
Product image
Recombinant Human TWF2 (mutated A6R) protein (Tagged) (ab268896)
Anti-Dystrophin antibody - BSA and Azide free (ab273544)

Overview

  • Product name

    Anti-CAPZA2 antibody
    See all CAPZA2 primary antibodies
  • Description

    Rabbit polyclonal to CAPZA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CAPZA2 aa 1-286.
    Sequence:

    MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGA AHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDH LRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDG QQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYE DGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTM SDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA


    Database link: P47755
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa, THP1, 22RV1, Mouse brain and Mouse heart lysates.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Binding Proteins

Images

  • Western blot - Anti-CAPZA2 antibody (ab175378)
    Western blot - Anti-CAPZA2 antibody (ab175378)
    All lanes : Anti-CAPZA2 antibody (ab175378) at 1/500 dilution

    Lane 1 : HeLa lysate
    Lane 2 : THP1 lysate
    Lane 3 : 22RV1 lysate
    Lane 4 : Mouse brain lysate
    Lane 5 : Mouse heart lysate

    Predicted band size: 33 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat kidney tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CAPZA2 antibody (ab175378)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast cancer tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunocytochemistry/ Immunofluorescence - Anti-CAPZA2 antibody (ab175378)
    Immunocytochemistry/ Immunofluorescence - Anti-CAPZA2 antibody (ab175378)
    Immunocytochemistry/Immunofluorescence analysis of HepG2 cells using ab175378. Blue DAPI for nuclear staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-CAPZA2 antibody (ab175378)

  •  
  • Product image

    Anti-CAPZA2 antibody (ab101451)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-COX11 antibody (ab238902)

  •  
  • Recombinant Human proCathepsin D protein (ab151860)

  •  
  • Product image

    Recombinant Human CD79a protein (His tag) (ab276512)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.