Anti-Calpain 15/SOLH antibody (ab174649)
Key features and details
- Rabbit polyclonal to Calpain 15/SOLH
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Calpain 15/SOLH antibody
See all Calpain 15/SOLH primary antibodies -
Description
Rabbit polyclonal to Calpain 15/SOLH -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species WB Human -
Immunogen
Synthetic peptide within Human Calpain 15/SOLH aa 25-75 (N terminal). The exact sequence is proprietary.
Sequence:ICEAPRHKPDLNHILRLSVEEQKWPCARCTFRNFLGKEACEVCGFTPEPA P
Database link: O75808 -
Positive control
- 293T, HeLa and Jurkat whole cell lysates.
-
General notes
This product was previously labelled as Calpain 15
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Calpain 15/SOLH antibody (ab174649) at 0.200000002980232 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 117 kDa
Exposure time: 3 minutes

