Anti-C5a-R antibody [P12/1] (ab24036)
Key features and details
- Mouse monoclonal [P12/1] to C5a-R
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-C5a-R antibody [P12/1]
See all C5a-R primary antibodies -
Description
Mouse monoclonal [P12/1] to C5a-R -
Host species
Mouse -
Specificity
No P12/1 signal after pre-incubation of HMC-1 cells with C5a, meaning that P12/1 does not displace C5a.
-
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide corresponding to Human C5a-R aa 1-31 (N terminal).
Sequence:MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.3
Preservative: 0.09% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Affinity purified -
Clonality
Monoclonal -
Clone number
P12/1 -
Isotype
IgG2a -
Research areas