Anti-C21orf66 antibody (ab176590)
Key features and details
- Rabbit polyclonal to C21orf66
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-C21orf66 antibody -
Description
Rabbit polyclonal to C21orf66 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human C21orf66 aa 225-275. The exact sequence is proprietary. (NP_057715.2).
Sequence:IHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIV F
Database link: Q9Y5B6 -
Positive control
- HeLa and 293T whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176590 was affinity purified using an epitope specific to C21orf66 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunoprecipitation - Anti-C21orf66 antibody (ab176590)
Detection of C21orf66 by Western Blot of Immunprecipitate.
ab176590 at 1µg/ml labeling C21orf66 in HeLa whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176590 at 6µg/mg lysate.Detection: Chemiluminescence with exposure time of 3 seconds.
-
Western blot - Anti-C21orf66 antibody (ab176590)All lanes : Anti-C21orf66 antibody (ab176590) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 105 kDa
Exposure time: 30 seconds