Anti-c-Jun antibody (ab31419)
Key features and details
- Rabbit polyclonal to c-Jun
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-c-Jun antibody
See all c-Jun primary antibodies -
Description
Rabbit polyclonal to c-Jun -
Host species
Rabbit -
Specificity
Antibody detects endogenous levels of c-Jun protein around Serine 243. -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P HumanWB Human -
Immunogen
Synthetic peptide within Human c-Jun aa 210-259. The exact sequence is proprietary.
Sequence:HLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKR
Database link: P05412 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 0.87% Sodium chloride
Without Mg2+ and Ca2+ -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Paraffin-embedded human breast carcinoma tissue stained for c-Jun with ab31419 at a 1/50 dilution in immunohistochemical analysis.
Left panel: Untreated.
Right panel: Pre-incubated with synthesized peptide.
-
ICC/IF image of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling c-Jun (green) with ab31419 at 1 µg/ml. The cells were fixed in 4% PFA (10 minutes) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1 hour to permeabilize the cells and block non-specific protein-protein interactions. The cells were then incubated with ab31419 at 1 µg/ml overnight at +4 °C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) ab150077 used at a 1/1000 dilution for 1 hour. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1 hour. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43 µM.
-
All lanes : Anti-c-Jun antibody (ab31419) at 1/500 dilution
Lane 1 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells
Lane 2 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells with immunizing peptide
Predicted band size: 36 kDa
Observed band size: 43 kDa why is the actual band size different from the predicted?
-
Anti-c-Jun antibody (ab31419) at 1/500 dilution + Recombinant Human c-Jun protein (ab54318) at 0.01 µg
Secondary
Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 36 kDa
Exposure time: 30 seconds