Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Domain Families HLH / Leucine Zipper Leucine Zipper

Anti-c-Jun antibody (ab31419)

Price and availability

335 040 ₸

Availability

Order now and get it on Wednesday March 10, 2021

Anti-c-Jun antibody (ab31419)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to c-Jun
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-MAFF antibody (ab198249)
Product image
Anti-Sacsin antibody [EPR11864] - BSA and Azide free (ab250414)
Product image
Human ATF6 knockout HeLa cell lysate (ab256841)
Recombinant Human ATF2 protein (ab43598)

Overview

  • Product name

    Anti-c-Jun antibody
    See all c-Jun primary antibodies
  • Description

    Rabbit polyclonal to c-Jun
  • Host species

    Rabbit
  • Specificity

    Antibody detects endogenous levels of c-Jun protein around Serine 243.
  • Tested Applications & Species

    Application Species
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Synthetic peptide within Human c-Jun aa 210-259. The exact sequence is proprietary.
    Sequence:

    HLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKR


    Database link: P05412
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 0.87% Sodium chloride

    Without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • HLH / Leucine Zipper
    • Leucine Zipper
    • Signal Transduction
    • Signaling Pathway
    • Nuclear Signaling
    • SMADs
    • Epigenetics and Nuclear Signaling
    • Nuclear Signaling Pathways
    • SMADs
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Cancer
    • Oncoproteins/suppressors
    • Oncoproteins
    • Transcription factors
    • Immunology
    • Innate Immunity
    • TLR Signaling
    • Kits/ Lysates/ Other
    • Kits
    • ELISA Kits
    • ELISA Kits
    • Phosphoprotein ELISA kits

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-c-Jun antibody (ab31419)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-c-Jun antibody (ab31419)

    Paraffin-embedded human breast carcinoma tissue stained for c-Jun with ab31419 at a 1/50 dilution in immunohistochemical analysis.

    Left panel: Untreated.

    Right panel: Pre-incubated with synthesized peptide.

  • Immunocytochemistry/ Immunofluorescence - Anti-c-Jun antibody (ab31419)
    Immunocytochemistry/ Immunofluorescence - Anti-c-Jun antibody (ab31419)

    ICC/IF image of  HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling c-Jun (green) with ab31419 at 1 µg/ml. The cells were fixed in 4% PFA (10 minutes) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1 hour to permeabilize the cells and block non-specific protein-protein interactions. The cells were then incubated with ab31419 at 1 µg/ml overnight at +4 °C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) ab150077 used at a 1/1000 dilution for 1 hour. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1 hour. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43 µM.

  • Western blot - Anti-c-Jun antibody (ab31419)
    Western blot - Anti-c-Jun antibody (ab31419)
    All lanes : Anti-c-Jun antibody (ab31419) at 1/500 dilution

    Lane 1 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells
    Lane 2 : Extracts of Hela (Human epithelial cell line from cervix adenocarcinoma) cells with immunizing peptide

    Predicted band size: 36 kDa
    Observed band size: 43 kDa
    why is the actual band size different from the predicted?

  • Western blot - Anti-c-Jun antibody (ab31419)
    Western blot - Anti-c-Jun antibody (ab31419)
    Anti-c-Jun antibody (ab31419) at 1/500 dilution + Recombinant Human c-Jun protein (ab54318) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 36 kDa


    Exposure time: 30 seconds

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-c-Jun antibody (ab31419)

  •  
  • Product image

    Anti-c-Jun antibody [E254] - BSA and Azide free (ab218576)

    Applications: ChIP, IHC-P, IP, WB

  •  
  • Product image

    Anti-c-Jun (phospho T91) antibody [EPR2236] (ab79756)

    Applications: WB

  •  
  • Product image

    Anti-c-Jun antibody [EP693Y] (ab40766)

    Applications: Flow Cyt, ICC, IHC-P, IP, WB

  •  
  • Product image

    Anti-c-Jun antibody [E254] - ChIP Grade (ab32137)

    Applications: ChIP, IHC-P, IP, WB

  •  
  • Product image

    Anti-c-Jun (phospho S63) antibody [Y172] (ab32385)

    Applications: Dot, ELISA, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-c-Jun (phospho S63) antibody [Y172] - BSA and Azide free (ab227533)

    Applications: Dot, ELISA, ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-MDA5 antibody (ab79055)

  •  
  • Product image

    Anti-CD68 antibody (ab125047)

  •  
  • Product image

    Anti-SATB2 antibody (ab69998)

  •  
  • Product image

    Anti-NPEPPS antibody (ab77643)

  •  
  • Product image

    Anti-CD127 antibody (ab95024)

  •  
  • Product image

    Anti-M-CSF antibody (ab9693)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.