Anti-Arp3 antibody (ab175307)
Key features and details
- Rabbit polyclonal to Arp3
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human, African green monkey
- Isotype: IgG
Overview
-
Product name
Anti-Arp3 antibody
See all Arp3 primary antibodies -
Description
Rabbit polyclonal to Arp3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human Arp3 aa 1-418.
Sequence:MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRR VMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKY LRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALA ASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI TYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGS KWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDY EEIGPSICRHNPVFGVMS
Database link: P61158 -
Positive control
- K562, HL60, HeLa, Jurkat, Cos1, Cos7, mouse spleen and mouse liver lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Arp3 antibody (ab175307)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling Arp3 with ab175307 at 1/200. Magnification: 400x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Arp3 antibody (ab175307)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling Arp3 with ab175307 at 1/200. Magnification: 400x.
-
All lanes : Anti-Arp3 antibody (ab175307) at 1/500 dilution
Lane 1 : K562 cell lysate
Lane 2 : HL60 cell lysate
Lane 3 : HeLa cell lysate
Lane 4 : Jurkat cell lysate
Lane 5 : COS-1 (African green monkey kidney fibroblast-like cell line) cell lysate
Lane 6 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate
Lane 7 : mouse spleen lysate
Lane 8 : mouse liver lysate
Predicted band size: 47 kDa