Anti-ADFP antibody [2C5H8] (ab181452)
![Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211171-anti-adfp-antibody-2c5h8-western-blot.jpg "Anti-ADFP antibody [2C5H8] (ab181452)")
Key features and details
- Mouse monoclonal [2C5H8] to ADFP
- Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-ADFP antibody [2C5H8]
See all ADFP primary antibodies -
Description
Mouse monoclonal [2C5H8] to ADFP -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB HumanRecombinant fragment
-
Immunogen
Recombinant fragment corresponding to Human ADFP aa 268-437. Expressed in E. coli.
Sequence:VEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGV PQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESL DDVMDYLVNNTPLNWLVGPFYPQLT ESQNAQDQGA EMDKSSQETQ RSEHKTH
Database link: Q99541 -
Positive control
- ADFP recombinant protein; ADFP transfected HEK293 cell lysate; HepG2 cells and cell lysate; Human rectum cancer tissue; Human bladder cancer tissue.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR197175-12 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% stabilization buffer (amino acid =85% pH(1% water solution) =7.0~7.5, Water =2% As(mg/kg) =0.5 Pb(mg/kg) =0.1) -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2C5H8 -
Isotype
IgG1 -
Research areas
Images
-
Western blot - Anti-ADFP antibody [2C5H8] (ab181452)Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution + HepG2 cell lysate
-
![Western blot - Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211169-anti-adfp-antibody-2c5h8-western-blot.jpg)
Western blot - Anti-ADFP antibody [2C5H8] (ab181452)All lanes : Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : ADFP-transfected HEK293 cell lysate
-
![Western blot - Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211168-anti-adfp-antibody-2c5h8-western-blot.jpg)
Western blot - Anti-ADFP antibody [2C5H8] (ab181452)Anti-ADFP antibody [2C5H8] (ab181452) at 1/500 dilution + ADFP recombinant protein
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211167-anti-adfp-antibody-2c5h8-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5H8] (ab181452)Immunohistochemical analysis of paraffin-embedded Human bladder cancer tissue labeling ADFP with ab181452 at 1/200 dilution.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211166-anti-adfp-antibody-2c5h8-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ADFP antibody [2C5H8] (ab181452)Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling ADFP with ab181452 at 1/200 dilution.
-
![Immunocytochemistry/ Immunofluorescence - Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211165-anti-adfp-antibody-2c5h8-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-ADFP antibody [2C5H8] (ab181452)Immunofluorescent analysis of HepG2 cells labeling ADFP with ab181452 (green) at 1/200 dilution. Blue: DRAQ5 fluorescent DNA dye.
-
![Flow Cytometry - Anti-ADFP antibody [2C5H8] (ab181452)](https://www.abcam.com/ps/products/181/ab181452/Images/ab181452-211164-anti-adfp-antibody-2c5h8-flow-cytometry.jpg)
Flow Cytometry - Anti-ADFP antibody [2C5H8] (ab181452)Flow cytometric analysis of HepG2 cells labeling ADFP with ab181452 (green) at 1/200 dilution, and negative control (red).
