VSTX3, Voltage gated sodium channel blocker (ab145561)
Key features and details
- Voltage gated sodium channel blocker
- CAS Number:
- Purity: > 98%
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
VSTX3, Voltage gated sodium channel blocker -
Description
Voltage gated sodium channel blocker -
Biological description
Voltage gated sodium channel blocker. Inhibits NaV1.3, NaV1.7 and NaV1.8 channels. -
Purity
> 98% -
Chemical structure
Properties
-
Molecular weight
4171.74 -
Molecular formula
C182H261N51O51S6 -
Sequence
DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Modifications: Disulfide bonds: 2-17, 9-22, 16-29) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas