SureLight® APC Anti-PGE2 receptor EP4 subtype antibody (ab92763)
Key features and details
- SureLight® APC Rabbit polyclonal to PGE2 receptor EP4 subtype
- Suitable for: ICC/IF
- Reacts with: Human
- Conjugation: SureLight® APC. Ex: 652nm, Em: 657nm
- Isotype: IgG
Overview
-
Product name
SureLight® APC Anti-PGE2 receptor EP4 subtype antibody
See all PGE2 receptor EP4 subtype primary antibodies -
Description
SureLight® APC Rabbit polyclonal to PGE2 receptor EP4 subtype -
Host species
Rabbit -
Conjugation
SureLight® APC. Ex: 652nm, Em: 657nm -
Specificity
ab92763 is reactive with EP4 receptor and non-reactive with EP1, EP2, and EP3 receptors. -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF Human -
Immunogen
Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
Sequence:GSGRAGPAPKGSSLQVTFPSETLNLSEKCI
-
General notes
This product was previously labelled as Prostaglandin E Receptor EP4
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.20
Preservative: 0.013% Sodium azide
Constituents: 1.64% Sodium phosphate, 0.58% Sodium chloride -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunocytochemistry/ Immunofluorescence - SureLight® APC Anti-PGE2 receptor EP4 subtype antibody (ab92763)
ICC/IF image of ab92763 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab92763, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.