Recombinant Yersinia pestis F1 antigen protein (His tag) (ab241388)
Key features and details
- Expression system: Yeast
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Yersinia pestis F1 antigen protein (His tag)
See all Yersinia pestis F1 antigen proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Yersinia pestis -
Sequence
ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGG YKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISP KVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ -
Predicted molecular weight
18 kDa including tags -
Amino acids
22 to 170 -
Tags
His tag N-Terminus -
Additional sequence information
This product is the mature full length protein from aa 22 to 170. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Yersinia pestis F1 antigen protein (His tag) (ab241388)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241388.
-
Mass Spectrometry - Recombinant Yersinia pestis F1 antigen protein (His tag) (ab241388)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab241388 could indicate that this peptide derived from Yeast-expressed Yersinia pestis F1 antigen protein.
-
Mass Spectrometry - Recombinant Yersinia pestis F1 antigen protein (His tag) (ab241388)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab241388 could indicate that this peptide derived from Yeast-expressed Yersinia pestis F1 antigen protein.
