Recombinant staphylococcus aureus Glutamyl endopeptidase protein (ab98127)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
-
Product name
Recombinant staphylococcus aureus Glutamyl endopeptidase protein
See all Glutamyl endopeptidase proteins and peptides -
Biological activity
ab98127 cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Reaction Buffer: 10 mM Tris, pH 8.0 -
Purity
> 95 % SDS-PAGE.
ab98127 is sterile filtered through a 0.2 micron filter. Purity is > 95% by SDS-PAGE gel and HPLC analyses. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Staphylococcus aureus -
Sequence
LPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPN EQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITY LKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENV RNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPD NPDNGDNNNSDNPDAA -
Predicted molecular weight
29 kDa -
Amino acids
71 to 336
Specifications
Our Abpromise guarantee covers the use of ab98127 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
ab98127 cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Reaction Buffer: 10 mM Tris, pH 8.0 ab98127 cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Reaction Buffer: 10 mM Tris, pH 8.0 -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Constituent: 0.121% Tris
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionThe lyophilized protein is stable at room temperature for up to 1 month. Reconstitute in water to a concentration of 0.1-1.0 mg/ml.
General Info
-
Alternative names
- Endoproteinase Glu C
- sspA
- Staphylococcal serine proteinase
see all -
Relevance
Glutamyl endopeptidase preferentially cleaves peptide bonds on the carboxyl-terminal side of aspartate and glutamate. Along with other extracellular proteases it is involved in colonization and infection of human tissues. It is required for proteolytic maturation of thiol protease sspB and inactivation of sspC, an inhibitor of sspB. It is the most important protease for degradation of fibronectin-binding protein (FnBP) and surface protein A, which are involved in adherence to host cells. It may also protect bacteria against host defense mechanism by cleaving the immunoglobulin classes IgG, IgA and IgM. It may be involved in the stability of secreted lipases.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab98127 has not yet been referenced specifically in any publications.
Preparation and Storage
- Endoproteinase Glu C
- sspA
- Staphylococcal serine proteinase