Anti-PSMD7/Mov34 antibody (ab140428)
Key features and details
- Rabbit polyclonal to PSMD7/Mov34
- Suitable for: WB, IP, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PSMD7/Mov34 antibody
See all PSMD7/Mov34 primary antibodies -
Description
Rabbit polyclonal to PSMD7/Mov34 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Xenopus laevis, Chimpanzee, Drosophila melanogaster, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
-
Immunogen
Synthetic peptide corresponding to Human PSMD7/Mov34 aa 150-200.
Sequence:PTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLK G
Database link: NP_002802.2 -
Positive control
- 293T, HeLa, Jurkat and NIH 3T3 whole cell lysates.
-
General notes
This product was previously labelled as PSMD7
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab140428 was affinity purified using an epitope specific to PSMD7/Mov34 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSMD7/Mov34 antibody (ab140428)
Immunohistochemistry of human ovarian carcinoma using ab140428 at 1/1000. Detected using DAB.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSMD7/Mov34 antibody (ab140428)Immunohistochemistry of human lung carcinoma using ab140428 at 1/1000. Counterstained with hematoxylin, detected using DAB.
-
Western blot - Anti-PSMD7/Mov34 antibody (ab140428)All lanes : Anti-PSMD7/Mov34 antibody (ab140428) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH 3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 37 kDa
Exposure time: 3 minutes
-
Immunoprecipitation - Anti-PSMD7/Mov34 antibody (ab140428)Detection of PSMD7/Mov34 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140428 at 6 µg/mg lysate for IP and 1µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.
