Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Proteasome

Anti-PSMD7/Mov34 antibody (ab140428)

Anti-PSMD7/Mov34 antibody (ab140428)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to PSMD7/Mov34
  • Suitable for: WB, IP, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Proteasome 20S beta 6 antibody [EPR9684] - BSA and Azide free (ab248961)
Product image
Anti-PSMC5 antibody [EPR13566(B)] - C-terminal (ab180495)
Product image
Anti-Proteasome 26S S2/PSMD2 antibody (ab98865)
Product image
Anti-PSME1 antibody [EPR10968(B)] - BSA and Azide free (ab249230)

Overview

  • Product name

    Anti-PSMD7/Mov34 antibody
    See all PSMD7/Mov34 primary antibodies
  • Description

    Rabbit polyclonal to PSMD7/Mov34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Xenopus laevis, Chimpanzee, Drosophila melanogaster, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide corresponding to Human PSMD7/Mov34 aa 150-200.
    Sequence:

    PTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLK G


    Database link: NP_002802.2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, Jurkat and NIH 3T3 whole cell lysates.
  • General notes

     This product was previously labelled as PSMD7

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab140428 was affinity purified using an epitope specific to PSMD7/Mov34 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Proteasome
    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • Deubiquitination

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSMD7/Mov34 antibody (ab140428)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSMD7/Mov34 antibody (ab140428)

    Immunohistochemistry of human ovarian carcinoma using ab140428 at 1/1000. Detected using DAB. 

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSMD7/Mov34 antibody (ab140428)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PSMD7/Mov34 antibody (ab140428)

    Immunohistochemistry of human lung carcinoma using ab140428 at 1/1000. Counterstained with hematoxylin, detected using DAB. 

  • Western blot - Anti-PSMD7/Mov34 antibody (ab140428)
    Western blot - Anti-PSMD7/Mov34 antibody (ab140428)
    All lanes : Anti-PSMD7/Mov34 antibody (ab140428) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH 3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 37 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation - Anti-PSMD7/Mov34 antibody (ab140428)
    Immunoprecipitation - Anti-PSMD7/Mov34 antibody (ab140428)

    Detection of PSMD7/Mov34 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140428 at 6 µg/mg lysate for IP and 1µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-PSMD7/Mov34 antibody (ab140428)

  •  
  • Product image

    Anti-PSMD7/Mov34 antibody [EPR13516(B)] (ab178417)

    Applications: Flow Cyt, IP, WB

  •  
  • Product image

    Anti-PSMD7/Mov34 antibody [EPR13517] (ab181072)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-PSMD7/Mov34 antibody (ab11436)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-PSMD7/Mov34 antibody (ab126263)

    Applications: ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Recombinant Human Huntingtin protein (Tagged) (ab112300)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.