Recombinant Staphylococcus aureus Glutamyl endopeptidase protein (ab222175)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Staphylococcus aureus Glutamyl endopeptidase protein
See all Glutamyl endopeptidase proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Staphylococcus aureus -
Sequence
MLPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKH VVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSP NEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKIT YLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINEN VRNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNP DNPDNGDNNNSDNPDAA -
Predicted molecular weight
29 kDa -
Amino acids
71 to 336
Specifications
Our Abpromise guarantee covers the use of ab222175 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 0.16% Sodium phosphate
Lyophilized from a sterile 0.2 micron filtered solution. -
ReconstitutionCentrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.
General Info
-
Alternative names
- Endoproteinase Glu C
- sspA
- Staphylococcal serine proteinase
see all -
Relevance
Glutamyl endopeptidase preferentially cleaves peptide bonds on the carboxyl-terminal side of aspartate and glutamate. Along with other extracellular proteases it is involved in colonization and infection of human tissues. It is required for proteolytic maturation of thiol protease sspB and inactivation of sspC, an inhibitor of sspB. It is the most important protease for degradation of fibronectin-binding protein (FnBP) and surface protein A, which are involved in adherence to host cells. It may also protect bacteria against host defense mechanism by cleaving the immunoglobulin classes IgG, IgA and IgM. It may be involved in the stability of secreted lipases.
Images
-
1 µg ab222175 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
ab222175 is predicted to have a molecuar weight of 28.9 kDa, but runs at about 35 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab222175 has not yet been referenced specifically in any publications.
Preparation and Storage
- Endoproteinase Glu C
- sspA
- Staphylococcal serine proteinase
Images
-
1 µg ab222175 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.
Lane 1: Non-reducing conditions.
Lane 2: Reducing conditions.
ab222175 is predicted to have a molecuar weight of 28.9 kDa, but runs at about 35 kDa.