Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cardiovascular Blood Acute Phase Reactants

Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)

Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 97% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies, HPLC

You may also be interested in

Product image
Anti-Serum Amyloid A antibody (ab200584)
Product image
Human Thrombin ELISA Kit (Factor II) (ab108909)
Product image
Anti-SAA4 antibody [EPR2926] - BSA and Azide free (ab247581)
Product image
Ceruloplasmin Activity Assay Kit (Colorimetric) (ab273296)

Description

  • Product name

    Recombinant rhesus monkey Serum Amyloid A protein (Active)
    See all Serum Amyloid A proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC
  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    F6V9N7
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rhesus monkey
    • Sequence

      RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPG GVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGL PEKY
    • Predicted molecular weight

      12 kDa
    • Amino acids

      19 to 122
    • Additional sequence information

      Full length mature chain without signal peptide.
  • Specifications

    Our Abpromise guarantee covers the use of ab243256 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Functional Studies

      HPLC

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Constituent: PBS

      0.2 µm filtered

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

    General Info

    • Alternative names

      • Amyloid fibrils
      • SAA 2
      • Serum amyloid A1 isoform 2
      • TP53I4
      • Amyloid fibril protein AA
      • Amyloid protein A
      • Fibrils
      • MGC111216
      • OC
      • OTTMUSP0000004557
      • PIG 4
      • PIG4
      • SAA
      • SAA 1
      • SAA_HUMAN
      • SAA1
      • SAA2
      • serum amyloid A
      • Serum amyloid A 1
      • Serum amyloid A protein precursor
      • Serum amyloid A1 isoform 1
      • Serum amyloid protein A(4-101)
      • Tumor protein p53 inducible protein 4
      see all
    • Relevance

      Function: Major acute phase reactant. Apolipoprotein of the HDL complex. Tissue specificity: Expressed by the liver; secreted in plasma. Disease: Note=Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Note=Elevated serum SAA protein levels may be associated with lung cancer. Similarity: Belongs to the SAA family. PTM: This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.

Images

  • SDS-PAGE - Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)
    SDS-PAGE - Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)
    SDS Page analysis of ab243256

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab243256? Please let us know so that we can cite the reference in this datasheet.

    ab243256 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Amyloid fibrils
    • SAA 2
    • Serum amyloid A1 isoform 2

    Images

    • SDS-PAGE - Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)
      SDS-PAGE - Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)
      SDS Page analysis of ab243256

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)

    •  
    • Product image

      Recombinant Human Serum Amyloid A protein (ab87757)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant Cat Serum Amyloid A protein (His tag) (ab224867)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant Dog Serum Amyloid A protein (Tagged) (ab224871)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant human Serum Amyloid A protein (ab50232)

      Applications: FuncS, SDS-PAGE, WB

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-SNRNP200 antibody (ab241589)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.