Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant rhesus monkey Serum Amyloid A protein (Active)
See all Serum Amyloid A proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Rhesus monkey -
Sequence
RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPG GVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGL PEKY -
Predicted molecular weight
12 kDa -
Amino acids
19 to 122 -
Additional sequence information
Full length mature chain without signal peptide.
Specifications
Our Abpromise guarantee covers the use of ab243256 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- Amyloid fibrils
- SAA 2
- Serum amyloid A1 isoform 2
see all -
Relevance
Function: Major acute phase reactant. Apolipoprotein of the HDL complex. Tissue specificity: Expressed by the liver; secreted in plasma. Disease: Note=Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Note=Elevated serum SAA protein levels may be associated with lung cancer. Similarity: Belongs to the SAA family. PTM: This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.
Images
-
SDS-PAGE - Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)SDS Page analysis of ab243256
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243256 has not yet been referenced specifically in any publications.
Preparation and Storage
- Amyloid fibrils
- SAA 2
- Serum amyloid A1 isoform 2
Images
-
SDS-PAGE - Recombinant rhesus monkey Serum Amyloid A protein (Active) (ab243256)SDS Page analysis of ab243256
