Recombinant rat VEGFC protein (ab52146)
Key features and details
- Expression system: Insect cells
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant rat VEGFC protein
See all VEGFC proteins and peptides -
Biological activity
This product is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT -4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR.
Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells (PAE/FLT -4 cells). The ED50 for this effect is typically 150-300 ng/ml. Inactive in the vascular permeability assay.
-
Purity
> 90 % SDS-PAGE.
Purity >90% by SDS-PAGE and visualised by silver stain. Product is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGFC by a Ser residue. -
Expression system
Insect cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH -
Amino acids
101 to 221 -
Modifications
mutated C152S -
Tags
His tag C-Terminus
-
Preparation and Storage
- Flt 4L
- Flt4 ligand
- FLT4 ligand DHM
Images
-
Functional Studies - Recombinant rat VEGFC protein (ab52146)
In vivo: The lymphangiogenic response to recombinant rat VEGF-CC152S loaded in our biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats. Briefly, after ischemia-reperfusion injury to induce myocardial infarction, VEGF-CC152S at the dose of 1.5 or 5 µg per heart was injected intra-myocardially. Lymphatic responses in the myocardium were analyzed by IHC at 3 weeks post-MI using LYVE1 antibody (RT, #103-PA50). Results are expressed as lymphatic vessel to cardiomyocyte ratio (mean ± sem).
-
SDS-PAGE - Recombinant rat VEGFC protein (ab52146)SDS-PAGE analysis of recombinant rat VEGF-C152 mutant. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue. -
Functional Studies - Recombinant rat VEGFC protein (ab52146)In vitro: The proliferative response to recombinant rat VEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells. Briefly, cells were plated in 12-well plates and incubated in DMEM medium supplemented with 1% fetal calf serum for cell cycle arrest 24h prior to stimulation of cell proliferation with recombinant VEGF-CC152S at the concentrations of 50 and 100 ng/mL. After 48h in culture, the cell proliferative response was assayed (WST-1 colorimetric assay), and the results expressed as % of control non-stimulated cells (mean ± sem).
