Recombinant rat CNTF protein (ab202798)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
-
Product name
Recombinant rat CNTF protein
See all CNTF proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using Human TF-1 cells is less than 30 ng/mL, corresponding to a specific activity of > 3.3 × 104 IU/mg.
-
Purity
> 95 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM -
Predicted molecular weight
23 kDa -
Amino acids
2 to 200
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 2% Trehalose, 97% PBSThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at
General Info
-
Alternative names
- Ciliary neurotrophic factor
- CNTF
- CNTF_HUMAN
- HCNTF
-
Function
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. -
Tissue specificity
Nervous system. -
Sequence similarities
Belongs to the CNTF family. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab202798 has not yet been referenced specifically in any publications.
-