Recombinant rabbit IL-2 protein (ab209169)
Key features and details
- Expression system: Yeast
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant rabbit IL-2 protein
See all IL-2 proteins and peptides -
Biological activity
The biological activity of recombinant rabbit IL-2 measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is typically 9.5 – 14.0 ng/mL.
-
Purity
> 95 % SDS-PAGE.
Purified by ion-exchange chromatography. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rabbit -
Sequence
APTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSKLSRMLTFKFYMPKKV TELKHLQCLEEELKPLEEVLNLAQGKNSHGGNTRESISNINVTVLKLKGS ETFMCEYDETVTIVEFLNRWITFCQSIISASSS -
Predicted molecular weight
15 kDa -
Amino acids
21 to 153 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Preparation and Storage
-
Alternative names
- Aldesleukin
- IL 2
- IL-2
see all -
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. -
Involvement in disease
Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. -
Sequence similarities
Belongs to the IL-2 family. -
Cellular localization
Secreted. - Information by UniProt