Recombinant Pseudomonas aeruginosa Regulatory protein RhlR (His tag) (ab225569)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Pseudomonas aeruginosa Regulatory protein RhlR (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Pseudomonas aeruginosa -
Sequence
MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHT IPFTRPKTEVHGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSL FDQSRMLWNEARDWGLCVGATLPIRAPNNLLSVLSVARDQQNISSFEREE IRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQWTADGKSSGE IAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGLI -
Predicted molecular weight
48 kDa including tags -
Amino acids
1 to 241 -
Tags
His tag N-Terminus -
Additional sequence information
10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 50% Glycerol, Tris buffer
Images
-
SDS-PAGE - Recombinant Pseudomonas aeruginosa Regulatory protein RhlR (His tag) (ab225569)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225569 with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant Pseudomonas aeruginosa Regulatory protein RhlR (His tag) (ab225569)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225569 could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Regulatory protein RhlR.
-
Mass Spectrometry - Recombinant Pseudomonas aeruginosa Regulatory protein RhlR (His tag) (ab225569)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225569 could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Regulatory protein RhlR.